| UniProt ID | BL1S5_HUMAN | |
|---|---|---|
| UniProt AC | Q8TDH9 | |
| Protein Name | Biogenesis of lysosome-related organelles complex 1 subunit 5 | |
| Gene Name | BLOC1S5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 187 | |
| Subcellular Localization | ||
| Protein Description | Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking.. | |
| Protein Sequence | MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSGGGTETP ------CCCCCCCCC | 22199227 | ||
| 2 | Acetylation | ------MSGGGTETP ------CCCCCCCCC | 19413330 | ||
| 6 | Phosphorylation | --MSGGGTETPVGCE --CCCCCCCCCCCCC | 22199227 | ||
| 8 | Phosphorylation | MSGGGTETPVGCEAA CCCCCCCCCCCCCCC | 22199227 | ||
| 20 | Phosphorylation | EAAPGGGSKKRDSLG CCCCCCCCCCCCCCC | 26074081 | ||
| 25 | Phosphorylation | GGSKKRDSLGTAGSA CCCCCCCCCCCCCCC | 23927012 | ||
| 28 | Phosphorylation | KKRDSLGTAGSAHLI CCCCCCCCCCCCEEE | 23927012 | ||
| 31 | Phosphorylation | DSLGTAGSAHLIIKD CCCCCCCCCEEEECC | 23927012 | ||
| 37 | Ubiquitination | GSAHLIIKDLGEIHS CCCEEEECCHHHHHH | - | ||
| 44 | Phosphorylation | KDLGEIHSRLLDHRP CCHHHHHHHHHHCCC | 24719451 | ||
| 62 | Ubiquitination | GETRYFVKEFEEKRG CCCHHHHHHHHHHHC | - | ||
| 80 | Ubiquitination | MRVLENLKNMIHETN HHHHHHHHHHHHHHC | - | ||
| 101 | Phosphorylation | CRDTMRDSLSQVLQR HHHHHHHHHHHHHHH | 25072903 | ||
| 103 | Phosphorylation | DTMRDSLSQVLQRLQ HHHHHHHHHHHHHHH | 27050516 | ||
| 131 | Phosphorylation | QERKKIHSDHLVASE HHHHHHHHCCHHHHH | 23312004 | ||
| 139 | Ubiquitination | DHLVASEKQHMLQWD CCHHHHHHHHHHHHH | - | ||
| 179 | Acetylation | EQYAEMEKDLAKFST HHHHHHHHHHHHHCC | 19822311 | ||
| 183 | Acetylation | EMEKDLAKFSTF--- HHHHHHHHHCCC--- | 19822319 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BL1S5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BL1S5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BL1S5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BL1S2_HUMAN | BLOC1S2 | physical | 15102850 | |
| DTBP1_HUMAN | DTNBP1 | physical | 15102850 | |
| A4_HUMAN | APP | physical | 21832049 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...