UniProt ID | BL1S5_HUMAN | |
---|---|---|
UniProt AC | Q8TDH9 | |
Protein Name | Biogenesis of lysosome-related organelles complex 1 subunit 5 | |
Gene Name | BLOC1S5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 187 | |
Subcellular Localization | ||
Protein Description | Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking.. | |
Protein Sequence | MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGGGTETP ------CCCCCCCCC | 22199227 | ||
2 | Acetylation | ------MSGGGTETP ------CCCCCCCCC | 19413330 | ||
6 | Phosphorylation | --MSGGGTETPVGCE --CCCCCCCCCCCCC | 22199227 | ||
8 | Phosphorylation | MSGGGTETPVGCEAA CCCCCCCCCCCCCCC | 22199227 | ||
20 | Phosphorylation | EAAPGGGSKKRDSLG CCCCCCCCCCCCCCC | 26074081 | ||
25 | Phosphorylation | GGSKKRDSLGTAGSA CCCCCCCCCCCCCCC | 23927012 | ||
28 | Phosphorylation | KKRDSLGTAGSAHLI CCCCCCCCCCCCEEE | 23927012 | ||
31 | Phosphorylation | DSLGTAGSAHLIIKD CCCCCCCCCEEEECC | 23927012 | ||
37 | Ubiquitination | GSAHLIIKDLGEIHS CCCEEEECCHHHHHH | - | ||
44 | Phosphorylation | KDLGEIHSRLLDHRP CCHHHHHHHHHHCCC | 24719451 | ||
62 | Ubiquitination | GETRYFVKEFEEKRG CCCHHHHHHHHHHHC | - | ||
80 | Ubiquitination | MRVLENLKNMIHETN HHHHHHHHHHHHHHC | - | ||
101 | Phosphorylation | CRDTMRDSLSQVLQR HHHHHHHHHHHHHHH | 25072903 | ||
103 | Phosphorylation | DTMRDSLSQVLQRLQ HHHHHHHHHHHHHHH | 27050516 | ||
131 | Phosphorylation | QERKKIHSDHLVASE HHHHHHHHCCHHHHH | 23312004 | ||
139 | Ubiquitination | DHLVASEKQHMLQWD CCHHHHHHHHHHHHH | - | ||
179 | Acetylation | EQYAEMEKDLAKFST HHHHHHHHHHHHHCC | 19822311 | ||
183 | Acetylation | EMEKDLAKFSTF--- HHHHHHHHHCCC--- | 19822319 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BL1S5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BL1S5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BL1S5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BL1S2_HUMAN | BLOC1S2 | physical | 15102850 | |
DTBP1_HUMAN | DTNBP1 | physical | 15102850 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...