| UniProt ID | SYCE3_HUMAN | |
|---|---|---|
| UniProt AC | A1L190 | |
| Protein Name | Synaptonemal complex central element protein 3 | |
| Gene Name | SYCE3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 88 | |
| Subcellular Localization | Nucleus . Chromosome . Colocalizes with SYCE1 in the central elements. | |
| Protein Description | Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility.. | |
| Protein Sequence | MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | ADPEERNYDNMLKML CCHHHHCHHHHHHHH | 18.21 | 22210691 | |
| 19 | Phosphorylation | DNMLKMLSDLNKDLE HHHHHHHHHHHHHHH | 36.23 | 26074081 | |
| 36 | Phosphorylation | LEEMEKISVQATWMA HHHHHHHHHHHHHHH | 21.17 | 21214269 | |
| 44 | Phosphorylation | VQATWMAYDMVVMRT HHHHHHHHHHHHHCC | 6.62 | 21214269 | |
| 54 | Phosphorylation | VVMRTNPTLAESMRR HHHCCCHHHHHHHHH | 40.44 | 21214269 | |
| 58 | Phosphorylation | TNPTLAESMRRLEDA CCHHHHHHHHHHHHH | 16.39 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYCE3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYCE3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYCE3_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...