UniProt ID | GSTK1_HUMAN | |
---|---|---|
UniProt AC | Q9Y2Q3 | |
Protein Name | Glutathione S-transferase kappa 1 | |
Gene Name | GSTK1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 226 | |
Subcellular Localization | Peroxisome . | |
Protein Description | Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).. | |
Protein Sequence | MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Succinylation | SLITGIMKDSGNKPP HHHHHHHCCCCCCCC | 46.99 | - | |
49 | Succinylation | SLITGIMKDSGNKPP HHHHHHHCCCCCCCC | 46.99 | - | |
54 (in isoform 2) | Malonylation | - | 56.99 | 26320211 | |
54 | Succinylation | IMKDSGNKPPGLLPR HHCCCCCCCCCCCCC | 56.99 | 27452117 | |
54 | Acetylation | IMKDSGNKPPGLLPR HHCCCCCCCCCCCCC | 56.99 | 26051181 | |
54 | Malonylation | IMKDSGNKPPGLLPR HHCCCCCCCCCCCCC | 56.99 | 26320211 | |
62 (in isoform 2) | Malonylation | - | 51.86 | 26320211 | |
62 | Ubiquitination | PPGLLPRKGLYMAND CCCCCCCCCEEECCH | 51.86 | - | |
62 | Malonylation | PPGLLPRKGLYMAND CCCCCCCCCEEECCH | 51.86 | 26320211 | |
65 | Phosphorylation | LLPRKGLYMANDLKL CCCCCCEEECCHHHH | 11.66 | 19835603 | |
71 | Ubiquitination | LYMANDLKLLRHHLQ EEECCHHHHHHHHCC | 48.62 | 21890473 | |
71 (in isoform 2) | Malonylation | - | 48.62 | 26320211 | |
71 (in isoform 2) | Ubiquitination | - | 48.62 | - | |
71 | Ubiquitination | LYMANDLKLLRHHLQ EEECCHHHHHHHHCC | 48.62 | - | |
71 | Ubiquitination | LYMANDLKLLRHHLQ EEECCHHHHHHHHCC | 48.62 | 21890473 | |
71 | Malonylation | LYMANDLKLLRHHLQ EEECCHHHHHHHHCC | 48.62 | 26320211 | |
71 | Acetylation | LYMANDLKLLRHHLQ EEECCHHHHHHHHCC | 48.62 | 19608861 | |
85 | Acetylation | QIPIHFPKDFLSVML CCCCCCCHHHHHHHH | 61.23 | - | |
89 | Phosphorylation | HFPKDFLSVMLEKGS CCCHHHHHHHHHHCC | 12.89 | 22985185 | |
94 | Acetylation | FLSVMLEKGSLSAMR HHHHHHHHCCHHHHH | 50.25 | 19413330 | |
96 | Phosphorylation | SVMLEKGSLSAMRFL HHHHHHCCHHHHHHH | 30.16 | 20068230 | |
98 | Phosphorylation | MLEKGSLSAMRFLTA HHHHCCHHHHHHHHH | 23.01 | 19413330 | |
104 | Phosphorylation | LSAMRFLTAVNLEHP HHHHHHHHHHCCCCH | 26.33 | 19413330 | |
116 (in isoform 2) | Ubiquitination | - | 47.93 | - | |
116 | Acetylation | EHPEMLEKASRELWM CCHHHHHHHHHHHHH | 47.93 | 25953088 | |
116 | Ubiquitination | EHPEMLEKASRELWM CCHHHHHHHHHHHHH | 47.93 | - | |
116 | Succinylation | EHPEMLEKASRELWM CCHHHHHHHHHHHHH | 47.93 | - | |
116 | Succinylation | EHPEMLEKASRELWM CCHHHHHHHHHHHHH | 47.93 | - | |
126 | Acetylation | RELWMRVWSRNEDIT HHHHHHHHHCCCCCC | 4.92 | 19608861 | |
144 | Succinylation | SILAAAEKAGMSAEQ HHHHHHHHHCCCHHH | 45.58 | - | |
144 | Succinylation | SILAAAEKAGMSAEQ HHHHHHHHHCCCHHH | 45.58 | - | |
144 | Acetylation | SILAAAEKAGMSAEQ HHHHHHHHHCCCHHH | 45.58 | 23954790 | |
147 | Sulfoxidation | AAAEKAGMSAEQAQG HHHHHHCCCHHHHHH | 4.02 | 21406390 | |
148 | Phosphorylation | AAEKAGMSAEQAQGL HHHHHCCCHHHHHHH | 27.95 | 21712546 | |
157 | Acetylation | EQAQGLLEKIATPKV HHHHHHHHHHCCHHH | 47.67 | 19608861 | |
158 | Succinylation | QAQGLLEKIATPKVK HHHHHHHHHCCHHHH | 37.30 | - | |
158 | Succinylation | QAQGLLEKIATPKVK HHHHHHHHHCCHHHH | 37.30 | - | |
158 | Acetylation | QAQGLLEKIATPKVK HHHHHHHHHCCHHHH | 37.30 | 20167786 | |
158 | Ubiquitination | QAQGLLEKIATPKVK HHHHHHHHHCCHHHH | 37.30 | - | |
161 | Phosphorylation | GLLEKIATPKVKNQL HHHHHHCCHHHHHHH | 27.41 | - | |
165 | Acetylation | KIATPKVKNQLKETT HHCCHHHHHHHHHHH | 45.14 | 25953088 | |
169 | Malonylation | PKVKNQLKETTEAAC HHHHHHHHHHHHHHH | 43.16 | 26320211 | |
169 | Ubiquitination | PKVKNQLKETTEAAC HHHHHHHHHHHHHHH | 43.16 | - | |
169 | Succinylation | PKVKNQLKETTEAAC HHHHHHHHHHHHHHH | 43.16 | 27452117 | |
169 | Acetylation | PKVKNQLKETTEAAC HHHHHHHHHHHHHHH | 43.16 | 19608861 | |
171 | Phosphorylation | VKNQLKETTEAACRY HHHHHHHHHHHHHHH | 28.48 | 28348404 | |
172 | Phosphorylation | KNQLKETTEAACRYG HHHHHHHHHHHHHHH | 25.39 | 28348404 | |
214 (in isoform 2) | Ubiquitination | - | 7.83 | - | |
225 (in isoform 2) | Malonylation | - | 35.41 | 26320211 | |
225 | Acetylation | IPPAVNARL------ CCHHHCCCC------ | 35.41 | 19608861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTK1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTK1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTK1_HUMAN !! |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00143 | Glutathione |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-71 AND LYS-169, AND MASSSPECTROMETRY. |