UniProt ID | FER3L_HUMAN | |
---|---|---|
UniProt AC | Q96RJ6 | |
Protein Name | Fer3-like protein | |
Gene Name | FERD3L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 166 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor that binds to the E-box and functions as inhibitor of transcription. DNA binding requires dimerization with an E protein. Inhibits transcription activation by ASCL1/MASH1 by sequestering E proteins (By similarity).. | |
Protein Sequence | MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
138 | Phosphorylation | FAYEKRLSRIETLRL HHHHHHHHHHHHHHH | 34.93 | 27174698 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FER3L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FER3L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FER3L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TFE2_HUMAN | TCF3 | physical | 28514442 | |
HTF4_HUMAN | TCF12 | physical | 28514442 | |
ITF2_HUMAN | TCF4 | physical | 28514442 | |
UBP19_HUMAN | USP19 | physical | 28514442 | |
HEXI2_HUMAN | HEXIM2 | physical | 28514442 | |
NEST_HUMAN | NES | physical | 28514442 | |
DMWD_HUMAN | DMWD | physical | 28514442 | |
COR2A_HUMAN | CORO2A | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...