| UniProt ID | FER3L_HUMAN | |
|---|---|---|
| UniProt AC | Q96RJ6 | |
| Protein Name | Fer3-like protein | |
| Gene Name | FERD3L | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 166 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription factor that binds to the E-box and functions as inhibitor of transcription. DNA binding requires dimerization with an E protein. Inhibits transcription activation by ASCL1/MASH1 by sequestering E proteins (By similarity).. | |
| Protein Sequence | MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 138 | Phosphorylation | FAYEKRLSRIETLRL HHHHHHHHHHHHHHH | 34.93 | 27174698 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FER3L_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FER3L_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FER3L_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TFE2_HUMAN | TCF3 | physical | 28514442 | |
| HTF4_HUMAN | TCF12 | physical | 28514442 | |
| ITF2_HUMAN | TCF4 | physical | 28514442 | |
| UBP19_HUMAN | USP19 | physical | 28514442 | |
| HEXI2_HUMAN | HEXIM2 | physical | 28514442 | |
| NEST_HUMAN | NES | physical | 28514442 | |
| DMWD_HUMAN | DMWD | physical | 28514442 | |
| COR2A_HUMAN | CORO2A | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...