UniProt ID | RRAAH_YEAST | |
---|---|---|
UniProt AC | P40011 | |
Protein Name | 4-hydroxy-4-methyl-2-oxoglutarate aldolase | |
Gene Name | YER010C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 234 | |
Subcellular Localization | ||
Protein Description | Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate. Also contains a secondary oxaloacetate (OAA) decarboxylase activity due to the common pyruvate enolate transition state formed following C-C bond cleavage in the retro-aldol and decarboxylation reactions.. | |
Protein Sequence | MSDLQKLQRFSTCDISDGLLNVYNIPTGGYFPNLTAISPPQNSSIVGTAYTVLFAPIDDPRPAVNYIDSVPPNSILVLALEPHLQSQFHPFIKITQAMYGGLMSTRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKILTSDGVTQTICPGDYIAGDNNGIVRIPVQETDISKLVTYIEKSIEVDLLVSEDIKNGIPAKQAQNDRRSVLKKYI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSDLQKLQR ------CCHHHHHHH | 22814378 | ||
95 | Phosphorylation | FHPFIKITQAMYGGL CCHHHHHHHHHHCCH | 27017623 | ||
99 | Phosphorylation | IKITQAMYGGLMSTR HHHHHHHHCCHHHHH | 27017623 | ||
109 | Phosphorylation | LMSTRAQYLKSNGTV HHHHHHHHHHHCCEE | 27017623 | ||
193 | Phosphorylation | PVQETDISKLVTYIE ECCHHCHHHHHHHHH | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRAAH_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRAAH_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRAAH_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...