| UniProt ID | AGR3_HUMAN | |
|---|---|---|
| UniProt AC | Q8TD06 | |
| Protein Name | Anterior gradient protein 3 | |
| Gene Name | AGR3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 166 | |
| Subcellular Localization | Endoplasmic reticulum . Found in the cytoplasm, which could include the endoplasmic reticulum. | |
| Protein Description | Required for calcium-mediated regulation of ciliary beat frequency and mucociliary clearance in the airway. Might be involved in the regulation of intracellular calcium in tracheal epithelial cells.. | |
| Protein Sequence | MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MMLHSALGLCLL ---CCHHHHHHHHHH | 22.64 | 46160587 | |
| 15 | O-linked_Glycosylation | GLCLLLVTVSSNLAI HHHHHHHHHCCCHHH | 18.03 | 29237092 | |
| 17 | O-linked_Glycosylation | CLLLVTVSSNLAIAI HHHHHHHCCCHHHHH | 12.25 | 29237092 | |
| 17 | Phosphorylation | CLLLVTVSSNLAIAI HHHHHHHCCCHHHHH | 12.25 | 46160583 | |
| 18 | O-linked_Glycosylation | LLLVTVSSNLAIAIK HHHHHHCCCHHHHHH | 31.37 | 29237092 | |
| 115 | Phosphorylation | NLSPDGQYVPRIMFV CCCCCCCEECEEEEE | 20.25 | 26074081 | |
| 125 | Phosphorylation | RIMFVDPSLTVRADI EEEEECCCCEEEEEE | 32.01 | 28348404 | |
| 127 | Phosphorylation | MFVDPSLTVRADIAG EEECCCCEEEEEECC | 16.57 | 28348404 | |
| 137 | Phosphorylation | ADIAGRYSNRLYTYE EEECCCCCCCEEECC | 17.70 | 101545447 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AGR3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AGR3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AGR3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DAG1_HUMAN | DAG1 | physical | 12592373 | |
| LYPD3_HUMAN | LYPD3 | physical | 12592373 | |
| ASB10_HUMAN | ASB10 | physical | 21988832 | |
| NUP62_HUMAN | NUP62 | physical | 21516116 | |
| UBQL1_HUMAN | UBQLN1 | physical | 21516116 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
