| UniProt ID | ATP12_YEAST | |
|---|---|---|
| UniProt AC | P22135 | |
| Protein Name | Protein ATP12, mitochondrial | |
| Gene Name | ATP12 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 325 | |
| Subcellular Localization | Mitochondrion . Mitochondrion intermembrane space . Mitochondrial, either as a constituent of the matrix, or in tenous association with the internal side of the inner membrane. | |
| Protein Description | Essential for the assembly of the mitochondrial F1-F0 complex.. | |
| Protein Sequence | MLPSLRKGCFIVNSIRLKLPRFYSLNAQPLGTDNTIENNTPTETNRLSKTSQKFWEKVSLNRDVEKGKIALQLDGRTIKTPLGNGIIVDNAKSLLAYLLKLEWSSLSSLSIKTHSLPLTSLVARCIDLQMTNEPGCDPQLVAKIGGNSDVIKNQLLRYLDTDTLLVFSPMNEFEGRLRNAQNELYIPIIKGMEEFLRNFSSESNIRLQILDADIHGLRGNQQSDIVKNAAKKYMSSLSPWDLAILEKTVLTTKSFICGVLLLENKKDTANLIPALKTDMDNIVRAATLETIFQVEKWGEVEDTHDVDKRDIRRKIHTAAIAAFKQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 57 | Acetylation | TSQKFWEKVSLNRDV HHHHHHHHHCCCCCH | 27.93 | 24489116 | |
| 266 | Acetylation | VLLLENKKDTANLIP HHHHCCCCCHHCCHH | 72.41 | 25381059 | |
| 308 | Acetylation | EDTHDVDKRDIRRKI CCCCCCCHHHHHHHH | 52.39 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP12_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP12_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP12_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
