ATG38_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATG38_YEAST
• UniProt AC: Q05789
• Protein Name: Autophagy-related protein 38 {ECO:0000303|PubMed:24165940}
• Gene Name: ATG38 {ECO:0000303|PubMed:24165940}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 226
• Subcellular Localization: Cytoplasm . Preautophagosomal structure membrane ; Peripheral membrane protein . Localization to the preautophagosomal structure requires ATG14.
• Protein Description: Autophagy-related protein required for cytoplasm to vacuole transport (Cvt) and autophagy as a part of the autophagy-specific VPS34 PI3-kinase complex I. This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure. ATG38 is required for the integrity of the active PI3-kinase complex I by maintaining an association between VPS15-VPS34 and ATG1P-VPS30 subcomplexes..
• Protein Sequence: MSTLAEVYTIIEDAEQECRKGDFTNAKAKYQEAIEVLGPQNENLSQNKLSSDVTQAIDLLKQDITAKIQELELLIEKQSSEENNIGMVNNNMLIGSVILNNKSPINGISNARNWDNPAYQDTLSPINDPLLMSILNRLQFNLNNDIQLKTEGGKNSKNSEMKINLRLEQFKKELVLYEQKKFKEYGMKIDEITKENKKLANEIGRLRERWDSLVESAKQRRDKQKN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSTLAEVYT ------CCCHHHHHH		22814378
67	Ubiquitination	LKQDITAKIQELELL HHHHHHHHHHHHHHH		24961812

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATG38_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATG38_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATG38_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NNF1_YEAST	NNF1	physical	22875988
VPS34_YEAST	VPS34	physical	24165940
VPS15_YEAST	VPS15	physical	24165940
BECN1_YEAST	VPS30	physical	24165940
ATG14_YEAST	ATG14	physical	24165940
ATG38_YEAST	ATG38	physical	24165940
YNE6_YEAST	YNL046W	genetic	27708008
TEP1_YEAST	TEP1	genetic	27708008
SFL1_YEAST	SFL1	genetic	27708008
ATG38_YEAST	ATG38	physical	27630019
VPS34_YEAST	VPS34	physical	27630019
VPS15_YEAST	VPS15	physical	27630019
ATG14_YEAST	ATG14	physical	27630019
BECN1_YEAST	VPS30	physical	27630019

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.