UniProt ID | ATG38_YEAST | |
---|---|---|
UniProt AC | Q05789 | |
Protein Name | Autophagy-related protein 38 {ECO:0000303|PubMed:24165940} | |
Gene Name | ATG38 {ECO:0000303|PubMed:24165940} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 226 | |
Subcellular Localization |
Cytoplasm . Preautophagosomal structure membrane Peripheral membrane protein . Localization to the preautophagosomal structure requires ATG14. |
|
Protein Description | Autophagy-related protein required for cytoplasm to vacuole transport (Cvt) and autophagy as a part of the autophagy-specific VPS34 PI3-kinase complex I. This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure. ATG38 is required for the integrity of the active PI3-kinase complex I by maintaining an association between VPS15-VPS34 and ATG1P-VPS30 subcomplexes.. | |
Protein Sequence | MSTLAEVYTIIEDAEQECRKGDFTNAKAKYQEAIEVLGPQNENLSQNKLSSDVTQAIDLLKQDITAKIQELELLIEKQSSEENNIGMVNNNMLIGSVILNNKSPINGISNARNWDNPAYQDTLSPINDPLLMSILNRLQFNLNNDIQLKTEGGKNSKNSEMKINLRLEQFKKELVLYEQKKFKEYGMKIDEITKENKKLANEIGRLRERWDSLVESAKQRRDKQKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG38_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG38_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG38_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NNF1_YEAST | NNF1 | physical | 22875988 | |
VPS34_YEAST | VPS34 | physical | 24165940 | |
VPS15_YEAST | VPS15 | physical | 24165940 | |
BECN1_YEAST | VPS30 | physical | 24165940 | |
ATG14_YEAST | ATG14 | physical | 24165940 | |
ATG38_YEAST | ATG38 | physical | 24165940 | |
YNE6_YEAST | YNL046W | genetic | 27708008 | |
TEP1_YEAST | TEP1 | genetic | 27708008 | |
SFL1_YEAST | SFL1 | genetic | 27708008 | |
ATG38_YEAST | ATG38 | physical | 27630019 | |
VPS34_YEAST | VPS34 | physical | 27630019 | |
VPS15_YEAST | VPS15 | physical | 27630019 | |
ATG14_YEAST | ATG14 | physical | 27630019 | |
BECN1_YEAST | VPS30 | physical | 27630019 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...