| UniProt ID | SBA1_YEAST | |
|---|---|---|
| UniProt AC | P28707 | |
| Protein Name | Co-chaperone protein SBA1 | |
| Gene Name | SBA1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 216 | |
| Subcellular Localization | ||
| Protein Description | Acts as a co-chaperone.. | |
| Protein Sequence | MSDKVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDENVHHYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDKWVDEDEQDEVEAEGNDAAQGMDFSQMMGGAGGAGGAGGMDFSQMMGGAGGAGSPDMAQLQQLLAQSGGNLDMGDFKENDEEDEEEEIEPEVKA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSDKVINPQ ------CCCCCCCHH | 46.25 | 9298649 | |
| 2 | Phosphorylation | ------MSDKVINPQ ------CCCCCCCHH | 46.25 | 28152593 | |
| 4 | Ubiquitination | ----MSDKVINPQVA ----CCCCCCCHHHH | 37.39 | 24961812 | |
| 4 | Acetylation | ----MSDKVINPQVA ----CCCCCCCHHHH | 37.39 | 24489116 | |
| 79 | Acetylation | YKEIIPEKTMHKVAN HHHHCCHHHHHHHHC | 45.88 | 22865919 | |
| 93 | Acetylation | NGQHYFLKLYKKDLE CCCEEEEEEHHHHHH | 39.61 | 24489116 | |
| 97 | Acetylation | YFLKLYKKDLESEYW EEEEEHHHHHHHCCC | 54.73 | 24489116 | |
| 113 | Acetylation | RLTKEKVKYPYIKTD CCCHHHCCCCEEECC | 52.13 | 24489116 | |
| 118 | Succinylation | KVKYPYIKTDFDKWV HCCCCEEECCHHHHC | 35.88 | 23954790 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SBA1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SBA1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SBA1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Proteome studies of Saccharomyces cerevisiae: identification andcharacterization of abundant proteins."; Garrels J.I., McLaughlin C.S., Warner J.R., Futcher B., Latter G.I.,Kobayashi R., Schwender B., Volpe T., Anderson D.S.,Mesquita-Fuentes R., Payne W.E.; Electrophoresis 18:1347-1360(1997). Cited for: ACETYLATION AT SER-2. | |
