LOA1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LOA1_YEAST
• UniProt AC: Q06508
• Protein Name: Lysophosphatidic acid:oleoyl-CoA acyltransferase 1
• Gene Name: LOA1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 300
• Subcellular Localization: Lipid droplet . Endoplasmic reticulum membrane ; Single-pass membrane protein . Lipid droplets consist of a surface phospholipid monolayer and a hydrophobic interior. The latter makes embedding of proteins containing transmembrane segments difficult,
• Protein Description: Acyl-CoA-dependent lysophosphatidic acid acyltransferase with preference for oleoyl-CoA. Involved in triacylglyceride homeostasis and lipid droplet formation. Involved in vacuolar protein sorting..
• Protein Sequence: MEKYTNWRDNGTGIAPFLPNTIRKPSKVMTACLLGILGVKTIIMLPLIMLYLLTGQNNLLGLILKFTFSWKEEITVQGIKKRDVRKSKHYPQKGKLYICNCTSPLDAFSVVLLAQGPVTLLVPSNDIVYKVSIREFINFILAGGLDIKLYGHEVAELSQLGNTVNFMFAEGTSCNGKSVLPFSITGKKLKEFIDPSITTMNPAMAKTKKFELQTIQIKTNKTAITTLPISNMEYLSRFLNKGINVKCKINEPQVLSDNLEELRVALNGGDKYKLVSRKLDVESKRNFVKEYISDQRKKRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
196	Phosphorylation	LKEFIDPSITTMNPA HHHHCCCCCCCCCHH	28.90	27017623
198	Phosphorylation	EFIDPSITTMNPAMA HHCCCCCCCCCHHHH	25.08	27017623
199	Phosphorylation	FIDPSITTMNPAMAK HCCCCCCCCCHHHHH	17.18	19779198
207	Phosphorylation	MNPAMAKTKKFELQT CCHHHHHCCCEEEEE	29.90	27017623
225	Phosphorylation	KTNKTAITTLPISNM ECCCCEEEECCCCCH	21.59	28889911
230	Phosphorylation	AITTLPISNMEYLSR EEEECCCCCHHHHHH	28.34	28889911
234	Phosphorylation	LPISNMEYLSRFLNK CCCCCHHHHHHHHHC	10.14	28889911
236	Phosphorylation	ISNMEYLSRFLNKGI CCCHHHHHHHHHCCC	21.78	28889911
289	Acetylation	ESKRNFVKEYISDQR HHHHHHHHHHHHHHH	40.43	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LOA1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LOA1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LOA1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AIM3_YEAST	AIM3	genetic	21035341
NAP1_YEAST	NAP1	physical	22940862
LOA1_YEAST	LOA1	physical	22940862
KPYK1_YEAST	CDC19	physical	22940862
SSB1_YEAST	SSB1	physical	22940862
PEP12_YEAST	PEP12	physical	22090344
DPM1_YEAST	DPM1	physical	22090344
PMA1_YEAST	PMA1	physical	22090344
VPH1_YEAST	VPH1	physical	22090344

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.