MFA1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MFA1_YEAST
• UniProt AC: P34165
• Protein Name: Mating hormone A-factor 1
• Gene Name: MFA1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 36
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: The active factor is excreted into the culture medium by haploid cells of the A mating type and acts on cells of the opposite mating type (type alpha). It mediates the conjugation process between the two types by inhibiting the initiation of DNA synthesis in type alpha cells and synchronizing them with type A..
• Protein Sequence: MQPSTATAAPKEKTSSEKKDNYIIKGVFWDPACVIA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
33	Methylation	GVFWDPACVIA---- EEEECCCCEEC----	2.50	3056940
33	Farnesylation	GVFWDPACVIA---- EEEECCCCEEC----	2.50	3056940
33	Farnesylation	GVFWDPACVIA---- EEEECCCCEEC----	2.50	3056940

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MFA1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MFA1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MFA1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MFA2_YEAST	MFA2	genetic	22672638

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Prenylation

"Structure of Saccharomyces cerevisiae mating hormone a-factor.Identification of S-farnesyl cysteine as a structural component.";
Anderegg R.J., Betz R., Carr S.A., Crabb J.W., Duntze W.;
J. Biol. Chem. 263:18236-18240(1988).
Cited for: ISOPRENYLATION AT CYS-33, AND MASS SPECTROMETRY.
PubMed: 3056940