UniProt ID | FMP41_YEAST | |
---|---|---|
UniProt AC | P53889 | |
Protein Name | Uncharacterized mitochondrial hydrolase FMP41 | |
Gene Name | FMP41 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 259 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MSYNYLKAARKIICIGRNYAAHIKELNNSTPKQPFFFLKPTSSIVTPLSSSLVKTTRPANSTFNGLNEDGTNPGPIFIPRGVKVHHEIELALIVSKHLSNVTKMKPEEVYDSISGVALALDLTARNVQDEAKKKGLPWTISKGFDTFMPISAIVSREKFSSYKSNLQDIFRVKCSVNGQLRQDGGTNLMLHPLHKILQHISTMISLEPGDIILTGTPAGVGELKPGDRVHCELLQNNDNIVDMNFECENRPGPYEFRET | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Acetylation | RNYAAHIKELNNSTP CCHHHHHHHHCCCCC | 46.40 | 24489116 | |
32 | Acetylation | ELNNSTPKQPFFFLK HHCCCCCCCCEEEEC | 71.36 | 24489116 | |
132 | Acetylation | RNVQDEAKKKGLPWT HCHHHHHHHCCCCCE | 53.63 | 25381059 | |
132 | Succinylation | RNVQDEAKKKGLPWT HCHHHHHHHCCCCCE | 53.63 | 23954790 | |
163 | Acetylation | REKFSSYKSNLQDIF HHHHHHCCCCHHHHE | 34.51 | 24489116 | |
202 | Phosphorylation | KILQHISTMISLEPG HHHHHHHHHHCCCCC | 20.23 | 19779198 | |
205 | Phosphorylation | QHISTMISLEPGDII HHHHHHHCCCCCCEE | 18.83 | 19779198 | |
216 | Phosphorylation | GDIILTGTPAGVGEL CCEEEECCCCCCCCC | 12.53 | 19779198 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FMP41_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FMP41_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FMP41_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VAC8_YEAST | VAC8 | physical | 16554755 | |
MAM33_YEAST | MAM33 | physical | 16554755 | |
NACB1_YEAST | EGD1 | physical | 16554755 | |
RL14A_YEAST | RPL14A | genetic | 27708008 | |
CTK1_YEAST | CTK1 | genetic | 27708008 | |
DCOR_YEAST | SPE1 | genetic | 27708008 | |
LDS1_YEAST | LDS1 | genetic | 27708008 | |
YAJ9_YEAST | YAR029W | genetic | 27708008 | |
MET8_YEAST | MET8 | genetic | 27708008 | |
RMD9L_YEAST | YBR238C | genetic | 27708008 | |
CHK1_YEAST | CHK1 | genetic | 27708008 | |
ACL4_YEAST | YDR161W | genetic | 27708008 | |
RLA4_YEAST | RPP2B | genetic | 27708008 | |
AIM11_YEAST | AIM11 | genetic | 27708008 | |
CGR1_YEAST | CGR1 | genetic | 27708008 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
PIR5_YEAST | YJL160C | genetic | 27708008 | |
SWE1_YEAST | SWE1 | genetic | 27708008 | |
COXM1_YEAST | CMC1 | genetic | 27708008 | |
CANB_YEAST | CNB1 | genetic | 27708008 | |
RSSA2_YEAST | RPS0B | genetic | 27708008 | |
SWI6_YEAST | SWI6 | genetic | 27708008 | |
RAD14_YEAST | RAD14 | genetic | 27708008 | |
GYP1_YEAST | GYP1 | genetic | 27708008 | |
POC4_YEAST | POC4 | genetic | 27708008 | |
YME1_YEAST | YME1 | genetic | 27708008 | |
QCR2_YEAST | QCR2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...