| UniProt ID | ATG31_YEAST | |
|---|---|---|
| UniProt AC | Q12421 | |
| Protein Name | Autophagy-related protein 31 | |
| Gene Name | ATG31 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 196 | |
| Subcellular Localization | Cytoplasm, cytoskeleton . Preautophagosomal structure. | |
| Protein Description | Plays a role in starvation-induced autophagy. Involved in mitophagy. Functions with ATG17 and ATG29 at the preautophagosomal structure (PAS) in order to form normal autophagosomes under starvation conditions. May be involved in microtubule function, such as chromosome segregation and karyogamy.. | |
| Protein Sequence | MNVTVTVYDKNVKYRLEENIKNNKGPSNDDQPAYNNESKSTDGSDYAMFPTNIKYIFEDNNDELVDSSDAALTAGIDKVGDELENVIIVQLDESGSLEDITLISDQYELLSHRTNSLSLEENQMRTLSSHGDDKSNDEEEELSVDSDRFRVDSDIELDVISQFCDLSPFLRDLSLNDLIKLYVTQNEQLQMLSNSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 41 | Phosphorylation | YNNESKSTDGSDYAM CCCCCCCCCCCCCCC | 27017623 | ||
| 44 | Phosphorylation | ESKSTDGSDYAMFPT CCCCCCCCCCCCCCC | 27017623 | ||
| 67 | Phosphorylation | NNDELVDSSDAALTA CCCCEECCHHHHHHH | 24961812 | ||
| 68 | Phosphorylation | NDELVDSSDAALTAG CCCEECCHHHHHHHC | 24961812 | ||
| 73 | Phosphorylation | DSSDAALTAGIDKVG CCHHHHHHHCCCHHC | 24961812 | ||
| 116 | Phosphorylation | LLSHRTNSLSLEENQ HHHHCCCCCCCCHHH | 27017623 | ||
| 128 | Phosphorylation | ENQMRTLSSHGDDKS HHHHHHHHHCCCCCC | 28889911 | ||
| 129 | Phosphorylation | NQMRTLSSHGDDKSN HHHHHHHHCCCCCCC | 28889911 | ||
| 135 | Phosphorylation | SSHGDDKSNDEEEEL HHCCCCCCCCCCHHC | 25704821 | ||
| 143 | Phosphorylation | NDEEEELSVDSDRFR CCCCHHCCCCCCCEE | 19795423 | ||
| 146 | Phosphorylation | EEELSVDSDRFRVDS CHHCCCCCCCEEECC | 19795423 | ||
| 174 | Phosphorylation | SPFLRDLSLNDLIKL HHHHHHCCHHHHHHH | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG31_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG31_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG31_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
