| UniProt ID | SEN54_YEAST | |
|---|---|---|
| UniProt AC | Q02825 | |
| Protein Name | tRNA-splicing endonuclease subunit SEN54 | |
| Gene Name | SEN54 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 467 | |
| Subcellular Localization |
Nucleus . Endomembrane system Peripheral membrane protein . Mitochondrion outer membrane Peripheral membrane protein Cytoplasmic side . The tRNA splicing endonuclease complex is predominantly associated with the outer membrane of mitochondria, |
|
| Protein Description | Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. May be required to embody the molecular ruler of the complex.. | |
| Protein Sequence | MQFAGKKTDQVTTSNPGFEEEEEEEEELQQDWSQLASLVSKNAALSLPKRGEKDYEPDGTNLQDLLLYNASKAMFDTISDSIRGTTVKSEVRGYYVPHKHQAVLLKPKGSFMQTMGRADSTGELWLDFHEFVYLAERGTILPYYRLEAGSNKSSKHETEILLSMEDLYSLFSSQQEMDQYFVFAHLKRLGFILKPSNQEAAVKTSFFPLKKQRSNLQAITWRLLSLFKIQELSLFSGFFYSKWNFFFRKYTTSPQLYQGLNRLVRSVAVPKNKKELLDAQSDREFQKVKDIPLTFKVWKPHSNFKKRDPGLPDFQVFVYNKNDDLQHFPTYKELRSMFSSLDYKFEFLSEIEDDDDWETNSYVEDIPRKEYIHKRSAKSQTEKSESSMKASFQKKTAQSSTKKKRKAYPPHIQQNRRLKTGYRSFIIAIMDNGLISFVKMSEADFGSESVWYTPNTQKKVDQRWKKH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 110 | Phosphorylation | VLLKPKGSFMQTMGR EEEECCCCHHHCCCC | 24.54 | 27017623 | |
| 114 | Phosphorylation | PKGSFMQTMGRADST CCCCHHHCCCCCCCC | 15.14 | 27017623 | |
| 120 | Phosphorylation | QTMGRADSTGELWLD HCCCCCCCCCCEEEE | 37.01 | 27017623 | |
| 121 | Phosphorylation | TMGRADSTGELWLDF CCCCCCCCCCEEEEH | 34.91 | 27017623 | |
| 287 | Acetylation | QSDREFQKVKDIPLT CCHHHHHHHCCCCEE | 57.48 | 24489116 | |
| 349 | Phosphorylation | DYKFEFLSEIEDDDD CCEEEEHHHCCCCCC | 41.68 | 27214570 | |
| 399 | Phosphorylation | FQKKTAQSSTKKKRK HHHHHCCCCCHHHHH | 37.19 | 28889911 | |
| 400 | Phosphorylation | QKKTAQSSTKKKRKA HHHHCCCCCHHHHHC | 31.97 | 28889911 | |
| 401 | Phosphorylation | KKTAQSSTKKKRKAY HHHCCCCCHHHHHCC | 52.72 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEN54_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEN54_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEN54_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
