UniProt ID | NNRE_YEAST | |
---|---|---|
UniProt AC | P40165 | |
Protein Name | NAD(P)H-hydrate epimerase {ECO:0000255|HAMAP-Rule:MF_03159} | |
Gene Name | YNL200C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 246 | |
Subcellular Localization | Cytoplasm. Mitochondrion. | |
Protein Description | Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX.. | |
Protein Sequence | MSTLKVVSSKLAAEIDKELMGPQIGFTLQQLMELAGFSVAQAVCRQFPLRGKTETEKGKHVFVIAGPGNNGGDGLVCARHLKLFGYNPVVFYPKRSERTEFYKQLVHQLNFFKVPVLSQDEGNWLEYLKPEKTLCIVDAIFGFSFKPPMREPFKGIVEELCKVQNIIPIVSVDVPTGWDVDKGPISQPSINPAVLVSLTVPKPCSSHIRENQTTHYVGGRFIPRDFANKFGFEPFGYESTDQILKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Acetylation | TLKVVSSKLAAEIDK CHHHHHHHHHHHHHH | 34.34 | 24489116 | |
82 | Acetylation | LVCARHLKLFGYNPV EEEEHHHHHCCCCCE | 35.33 | 24489116 | |
94 | Acetylation | NPVVFYPKRSERTEF CCEEECCCCHHHHHH | 58.12 | 24489116 | |
103 | Acetylation | SERTEFYKQLVHQLN HHHHHHHHHHHHHCC | 42.34 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NNRE_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NNRE_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NNRE_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MOB2_YEAST | MOB2 | genetic | 27708008 | |
NU192_YEAST | NUP192 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
ROT1_YEAST | ROT1 | genetic | 27708008 | |
GPI12_YEAST | GPI12 | genetic | 27708008 | |
TYSY_YEAST | CDC21 | genetic | 27708008 | |
UFE1_YEAST | UFE1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...