| UniProt ID | NNRE_YEAST | |
|---|---|---|
| UniProt AC | P40165 | |
| Protein Name | NAD(P)H-hydrate epimerase {ECO:0000255|HAMAP-Rule:MF_03159} | |
| Gene Name | YNL200C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 246 | |
| Subcellular Localization | Cytoplasm. Mitochondrion. | |
| Protein Description | Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX.. | |
| Protein Sequence | MSTLKVVSSKLAAEIDKELMGPQIGFTLQQLMELAGFSVAQAVCRQFPLRGKTETEKGKHVFVIAGPGNNGGDGLVCARHLKLFGYNPVVFYPKRSERTEFYKQLVHQLNFFKVPVLSQDEGNWLEYLKPEKTLCIVDAIFGFSFKPPMREPFKGIVEELCKVQNIIPIVSVDVPTGWDVDKGPISQPSINPAVLVSLTVPKPCSSHIRENQTTHYVGGRFIPRDFANKFGFEPFGYESTDQILKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Acetylation | TLKVVSSKLAAEIDK CHHHHHHHHHHHHHH | 34.34 | 24489116 | |
| 82 | Acetylation | LVCARHLKLFGYNPV EEEEHHHHHCCCCCE | 35.33 | 24489116 | |
| 94 | Acetylation | NPVVFYPKRSERTEF CCEEECCCCHHHHHH | 58.12 | 24489116 | |
| 103 | Acetylation | SERTEFYKQLVHQLN HHHHHHHHHHHHHCC | 42.34 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NNRE_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NNRE_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NNRE_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| NU192_YEAST | NUP192 | genetic | 27708008 | |
| KTHY_YEAST | CDC8 | genetic | 27708008 | |
| SEC22_YEAST | SEC22 | genetic | 27708008 | |
| ROT1_YEAST | ROT1 | genetic | 27708008 | |
| GPI12_YEAST | GPI12 | genetic | 27708008 | |
| TYSY_YEAST | CDC21 | genetic | 27708008 | |
| UFE1_YEAST | UFE1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...