UniProt ID | CCHL_YEAST | |
---|---|---|
UniProt AC | P06182 | |
Protein Name | Cytochrome c heme lyase | |
Gene Name | CYC3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 269 | |
Subcellular Localization | Mitochondrion inner membrane. Mitochondrion intermembrane space . | |
Protein Description | Links covalently the heme group to the apoprotein of cytochrome c.. | |
Protein Sequence | MGWFWADQKTTGKDIGGAAVSSMSGCPVMHESSSSSPPSSECPVMQGDNDRINPLNNMPELAASKQPGQKMDLPVDRTISSIPKSPDSNEFWEYPSPQQMYNAMVRKGKIGGSGEVAEDAVESMVQVHNFLNEGCWQEVLEWEKPHTDESHVQPKLLKFMGKPGVLSPRARWMHLCGLLFPSHFSQELPFDRHDWIVLRGERKAEQQPPTFKEVRYVLDFYGGPDDENGMPTFHVDVRPALDSLDNAKDRMTRFLDRMISGPSSSSSAP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 | Ubiquitination | ASKQPGQKMDLPVDR HCCCCCCCCCCCCCC | 40.05 | 23749301 | |
85 | Phosphorylation | TISSIPKSPDSNEFW CHHHCCCCCCCCCCC | 28.69 | 27017623 | |
88 | Phosphorylation | SIPKSPDSNEFWEYP HCCCCCCCCCCCCCC | 41.46 | 21440633 | |
94 | Phosphorylation | DSNEFWEYPSPQQMY CCCCCCCCCCHHHHH | 10.29 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCHL_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCHL_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCHL_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...