TVP23_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TVP23_ARATH
• UniProt AC: Q8LEK2
• Protein Name: Golgi apparatus membrane protein-like protein ECHIDNA
• Gene Name: ECH
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 186
• Subcellular Localization: Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.
• Protein Description: Mediates trans-Golgi-network trafficking and cell elongation. Required for keeping the appropriate balance between secretory trafficking and vacuolar targeting of a subset of proteins..
• Protein Sequence: MDPNNQIQAPVENYANPRTCLFHVLFKGAALAFYILSALFFNSFVIIFVVTVLLAALDFWVVKNVSGRILVGLRWWNEINDLGESVWKFESLDQESLARMNKKDSWLFWWTLYLAAAAWFILGVFSLIRFQADYLLVVGVCLSLNVANIIGFTKCKKDAKKQFQQFASQTIASRFQSTVQSAFTLV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDPNNQIQ -------CCCCCCCC		22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TVP23_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TVP23_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TVP23_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VHAA1_ARATH	VHA-A1	physical	21512130
RAA2A_ARATH	RAB11c	physical	21512130
SYP61_ARATH	SYP61	physical	21512130
NAC89_ARATH	NAC089	physical	21798944
NIP11_ARATH	NLM1	physical	21798944
RTNLB_ARATH	BTI2	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.