| UniProt ID | SYP61_ARATH | |
|---|---|---|
| UniProt AC | Q946Y7 | |
| Protein Name | Syntaxin-61 | |
| Gene Name | SYP61 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 245 | |
| Subcellular Localization |
Golgi apparatus, trans-Golgi network membrane Single-pass type IV membrane protein. Prevacuolar compartment membrane Single-pass type IV membrane protein. And along the cell wall inner surface. |
|
| Protein Description | Vesicle trafficking protein that functions in the secretory pathway. Involved in osmotic stress tolerance and in abscisic acid (ABA) regulation of stomatal responses.. | |
| Protein Sequence | MSSAQDPFYIVKEEIQDSIDKLQSTFHKWERISPDMGDQAHVAKELVATCGSIEWQVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGHASEVRRELMRMPNSGEASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGGVGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMMICFLLVLFIILFVLVFLT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 100 | Phosphorylation | TQVRNVKSGVLAGKV HHHHHCCCCCCCEEC | 29.83 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYP61_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYP61_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYP61_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SYP41_ARATH | SYP41 | physical | 11739776 | |
| SYP42_ARATH | SYP42 | physical | 11739776 | |
| VTI12_ARATH | VTI1B | physical | 11739776 | |
| RTNLH_ARATH | AT3G10260 | physical | 21798944 | |
| NAC89_ARATH | NAC089 | physical | 21798944 | |
| NUP35_ARATH | AT3G16310 | physical | 21798944 | |
| Y4645_ARATH | AT4G26450 | physical | 21798944 | |
| SY121_ARATH | SYP121 | physical | 25082856 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
