GON7_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GON7_YEAST
• UniProt AC: P46984
• Protein Name: EKC/KEOPS complex subunit GON7
• Gene Name: GON7
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 123
• Subcellular Localization: Nucleus . Chromosome, telomere .
• Protein Description: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. GON7 likely plays a supporting role to the catalytic subunit KAE1 in the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators..
• Protein Sequence: MKLPVAQYSAPDGVEKSFAPIRDDPRYMTTEGRTTGPSDHVLNAGQIDRDKPSEPERTKDGSQLTYLGQLRTQLTGLQDDINEFLTGRMELAKNKKKAGADEKRIQEEINQLLDGGDGDEDAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Acetylation	AGQIDRDKPSEPERT CHHCCCCCCCCCCCC	51.87	24489116
58	Phosphorylation	KPSEPERTKDGSQLT CCCCCCCCCCCCHHH	31.65	30377154
59	Ubiquitination	PSEPERTKDGSQLTY CCCCCCCCCCCHHHH	67.33	24961812
62	Phosphorylation	PERTKDGSQLTYLGQ CCCCCCCCHHHHHHH	31.95	30377154
72	Phosphorylation	TYLGQLRTQLTGLQD HHHHHHHHHHHCCHH	36.20	27017623
75	Phosphorylation	GQLRTQLTGLQDDIN HHHHHHHHCCHHHHH	26.48	28132839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GON7_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GON7_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GON7_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRS6A_YEAST	RPT5	physical	11283351
KAE1_YEAST	KAE1	physical	16554755
CG121_YEAST	CGI121	physical	16554755
KAE1_YEAST	KAE1	physical	16564010
CG121_YEAST	CGI121	physical	16564010
BUD32_YEAST	BUD32	physical	16564010
RIM1_YEAST	RIM1	genetic	17314980
BUD8_YEAST	BUD8	genetic	21625000
NACB2_YEAST	BTT1	physical	22875988
PFD2_YEAST	GIM4	physical	22875988
PRS6A_YEAST	RPT5	physical	22875988
RTK1_YEAST	RTK1	genetic	27708008
QRI7_YEAST	QRI7	genetic	27708008
SIW14_YEAST	SIW14	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.