| UniProt ID | HEL1_YEAST | |
|---|---|---|
| UniProt AC | P36113 | |
| Protein Name | E3 ubiquitin-protein ligase HEL1 {ECO:0000305|PubMed:22570702} | |
| Gene Name | HEL1 {ECO:0000303|PubMed:22570702} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 551 | |
| Subcellular Localization | ||
| Protein Description | Probable ubiquitin-protein ligase involved in the degradation-related ubiquitination of histones. Contributes to the post-translational regulation of histone protein levels by polyubiquitination of excess histones for subsequent degradation.. | |
| Protein Sequence | MSSGTENDQFYSFDESDSSSIELYESHNTSEFTIHGLVFPKLISVTSQDSEFDINEDEDGVDTIYEGMLDAPLTKNNKRILCEGSVPNLSYECLTTKGIFERMLQRVDHLQPIFAIPSADILILLQHYDWNEERLLEVWTEKMDELLVELGLSTTANIKKDNDYNSHFREVEFKNDFTCIICCDKKDTETFALECGHEYCINCYRHYIKDKLHEGNIITCMDCSLALKNEDIDKVMGHPSSSKLMDSSIKSFVQKHNRNYKWCPFADCKSIVHLRDTSSLPEYTRLHYSPFVKCNSFHRFCFNCGFEVHSPADCKITTAWVKKARKESEILNWVLSHTKECPKCSVNIEKNGGCNHMVCSSCKYEFCWICEGPWAPHGKNFFQCTMYKNNEDNKSKNPQDANKTLKKYTFYYRLFNEHEVSAKLDWNLGQTLGTKVHALQERIGISWIDGQFLSESLKVLNEGRTVLKWSFAVAYYSDASHNLTKIFVDNQMLLANAVESLSELLQIKTPEVIMKRRPEFYNKAGYVENRTTALMECGRELLCKGICKAAE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HEL1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HEL1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HEL1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBC4_YEAST | UBC4 | physical | 22570702 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...