UniProt ID | HEL1_YEAST | |
---|---|---|
UniProt AC | P36113 | |
Protein Name | E3 ubiquitin-protein ligase HEL1 {ECO:0000305|PubMed:22570702} | |
Gene Name | HEL1 {ECO:0000303|PubMed:22570702} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 551 | |
Subcellular Localization | ||
Protein Description | Probable ubiquitin-protein ligase involved in the degradation-related ubiquitination of histones. Contributes to the post-translational regulation of histone protein levels by polyubiquitination of excess histones for subsequent degradation.. | |
Protein Sequence | MSSGTENDQFYSFDESDSSSIELYESHNTSEFTIHGLVFPKLISVTSQDSEFDINEDEDGVDTIYEGMLDAPLTKNNKRILCEGSVPNLSYECLTTKGIFERMLQRVDHLQPIFAIPSADILILLQHYDWNEERLLEVWTEKMDELLVELGLSTTANIKKDNDYNSHFREVEFKNDFTCIICCDKKDTETFALECGHEYCINCYRHYIKDKLHEGNIITCMDCSLALKNEDIDKVMGHPSSSKLMDSSIKSFVQKHNRNYKWCPFADCKSIVHLRDTSSLPEYTRLHYSPFVKCNSFHRFCFNCGFEVHSPADCKITTAWVKKARKESEILNWVLSHTKECPKCSVNIEKNGGCNHMVCSSCKYEFCWICEGPWAPHGKNFFQCTMYKNNEDNKSKNPQDANKTLKKYTFYYRLFNEHEVSAKLDWNLGQTLGTKVHALQERIGISWIDGQFLSESLKVLNEGRTVLKWSFAVAYYSDASHNLTKIFVDNQMLLANAVESLSELLQIKTPEVIMKRRPEFYNKAGYVENRTTALMECGRELLCKGICKAAE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HEL1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HEL1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HEL1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBC4_YEAST | UBC4 | physical | 22570702 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...