| UniProt ID | HEM4_YEAST | |
|---|---|---|
| UniProt AC | P06174 | |
| Protein Name | Uroporphyrinogen-III synthase | |
| Gene Name | HEM4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 275 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes cyclization of the linear tetrapyrrole, hydroxymethylbilane, to the macrocyclic uroporphyrinogen III.. | |
| Protein Sequence | MSSRKKVRVLLLKNKTVPIDKYELECRSKAFEPIFVPLIKHTHVIQDFRNVLNTIPNYLNTINYIIITSQRTVESLNEAIIPTLTSEQKAALLSKTVYTVGPATANFIRRSGFINVKGGEDAGNGSILADIIIDDLSTDIKACPPSELLFLVGEIRRDIIPKKLHSKGIKVREVVTYKTEELSDGFKRFIHAMKECDEDEVFSDWVVVFSPQGTKEITQYLGDSNRLPGSHLRVASIGPTTKKYLDDNDVTSDVVSPKPDPKSLLDAIELYQRHK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Phosphorylation | VLLLKNKTVPIDKYE EEEECCCCCCCCCCE | 40.69 | 27017623 | |
| 21 | Acetylation | NKTVPIDKYELECRS CCCCCCCCCEEEEHH | 41.15 | 24489116 | |
| 22 | Phosphorylation | KTVPIDKYELECRSK CCCCCCCCEEEEHHC | 23.23 | 27017623 | |
| 40 | Acetylation | PIFVPLIKHTHVIQD CCCHHHHCCHHHHHH | 50.57 | 24489116 | |
| 258 | Acetylation | TSDVVSPKPDPKSLL CCCCCCCCCCHHHHH | 55.32 | 22865919 | |
| 263 | Phosphorylation | SPKPDPKSLLDAIEL CCCCCHHHHHHHHHH | 39.28 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HEM4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HEM4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HEM4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
