UniProt ID | HEM4_YEAST | |
---|---|---|
UniProt AC | P06174 | |
Protein Name | Uroporphyrinogen-III synthase | |
Gene Name | HEM4 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 275 | |
Subcellular Localization | ||
Protein Description | Catalyzes cyclization of the linear tetrapyrrole, hydroxymethylbilane, to the macrocyclic uroporphyrinogen III.. | |
Protein Sequence | MSSRKKVRVLLLKNKTVPIDKYELECRSKAFEPIFVPLIKHTHVIQDFRNVLNTIPNYLNTINYIIITSQRTVESLNEAIIPTLTSEQKAALLSKTVYTVGPATANFIRRSGFINVKGGEDAGNGSILADIIIDDLSTDIKACPPSELLFLVGEIRRDIIPKKLHSKGIKVREVVTYKTEELSDGFKRFIHAMKECDEDEVFSDWVVVFSPQGTKEITQYLGDSNRLPGSHLRVASIGPTTKKYLDDNDVTSDVVSPKPDPKSLLDAIELYQRHK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | VLLLKNKTVPIDKYE EEEECCCCCCCCCCE | 40.69 | 27017623 | |
21 | Acetylation | NKTVPIDKYELECRS CCCCCCCCCEEEEHH | 41.15 | 24489116 | |
22 | Phosphorylation | KTVPIDKYELECRSK CCCCCCCCEEEEHHC | 23.23 | 27017623 | |
40 | Acetylation | PIFVPLIKHTHVIQD CCCHHHHCCHHHHHH | 50.57 | 24489116 | |
258 | Acetylation | TSDVVSPKPDPKSLL CCCCCCCCCCHHHHH | 55.32 | 22865919 | |
263 | Phosphorylation | SPKPDPKSLLDAIEL CCCCCHHHHHHHHHH | 39.28 | 30377154 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HEM4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HEM4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HEM4_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...