YBM3_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YBM3_YEAST
• UniProt AC: P38215
• Protein Name: Putative uncharacterized protein YBR013C
• Gene Name: YBR013C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 129
• Protein Sequence: MIYPLFRICILGAFLLGSYACLENSTQKGIEGVTLSHNSVQINNTLAKSAPFCESDALSMNYSTENMLSNNACDYTKNSSYPYIITIITKAFDNALENSLNLQANRKLYHRVGTCIQNIFYQLLLTVNY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
81	Phosphorylation	DYTKNSSYPYIITII CCCCCCCCCEEEEEE	10.40	27017623
83	Phosphorylation	TKNSSYPYIITIITK CCCCCCCEEEEEEHH	9.20	27017623
86	Phosphorylation	SSYPYIITIITKAFD CCCCEEEEEEHHHHH	9.21	27017623
89	Phosphorylation	PYIITIITKAFDNAL CEEEEEEHHHHHHHH	16.69	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YBM3_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YBM3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YBM3_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YBM3_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.