| UniProt ID | RHO1_YEAST | |
|---|---|---|
| UniProt AC | P06780 | |
| Protein Name | GTP-binding protein RHO1 | |
| Gene Name | RHO1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 209 | |
| Subcellular Localization |
Cell membrane Lipid-anchor. Endosome membrane Lipid-anchor. Peroxisome membrane Lipid-anchor. Plasma membrane-associated at sites of polarized growth such as incipient bud sites, bud tips, the bud neck during cytokinesis, and the neck and tip of m |
|
| Protein Description | Acts as a central regulator in the cell wall integrity signaling pathway, which is regulated by the cell cycle and in response to various types of cell wall stress. Integrates signals from different cell surface sensors, and activates a set of effectors, regulating processes including beta-glucan synthesis at the site of wall remodeling, gene expression related to cell wall biogenesis, organization of the actin cytoskeleton, and protein- and secretory vesicle-targeting to the growth site. Activates the protein kinase C (PKC1) MAP kinase cascade, the beta-1,3-glucan synthase (FKS1), the formin BNI1, the exocyst component SEC3 and the transcription factor SKN7.. | |
| Protein Sequence | MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTEKKKKKCVLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSQQVGNSI ------CCHHCHHCH | 29.35 | 22814378 | |
| 2 | Phosphorylation | ------MSQQVGNSI ------CCHHCHHCH | 29.35 | 24909858 | |
| 8 | Phosphorylation | MSQQVGNSIRRKLVI CCHHCHHCHHCEEEE | 16.14 | 22369663 | |
| 167 | Ubiquitination | GYYECSAKTGYGVRE CEEECCCCCCCCHHH | 26.62 | 23749301 | |
| 188 | Phosphorylation | RASLMGKSKTNGKAK HHHHCCCCCCCCCCC | 38.70 | 27017623 | |
| 206 | Methylation | TEKKKKKCVLL---- CCHHHCCEEEC---- | 3.42 | - | |
| 206 | Geranylgeranylation | TEKKKKKCVLL---- CCHHHCCEEEC---- | 3.42 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHO1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHO1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHO1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
