| UniProt ID | YPS3_YEAST | |
|---|---|---|
| UniProt AC | Q12303 | |
| Protein Name | Aspartic proteinase yapsin-3 | |
| Gene Name | YPS3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 508 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . GPI-anchored plasma membrane protein (GPI-PMP). |
|
| Protein Description | Cleaves proteins C-terminally to mono- and paired-basic residues. Required for cell wall integrity.. | |
| Protein Sequence | MKLQLAAVATLAVLTSPAFGRVLPDGKYVKIPFTKKKNGDNGELSKRSNGHEKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSFAVANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAKYGTGKENVEVIKSTVPSAIRAPSYNNTWSNYASATSGGNIFTTVRTFNGTSTATTTRSTTTKKTNSTTTAKSTHKSKRALQRAATNSASSIRSTLGLLLVPSLLILSVFFS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | N-linked_Glycosylation | AIGTPSQNLTVLLDT EEECCCCCEEEEEEC | 41.85 | - | |
| 120 | N-linked_Glycosylation | KSSTFKANKSSPFYA CCCCCCCCCCCCCEE | 45.38 | - | |
| 160 | N-linked_Glycosylation | GLSFAVANESNSTFG CCEEEEECCCCCCEE | 46.78 | - | |
| 163 | N-linked_Glycosylation | FAVANESNSTFGVLG EEEECCCCCCEEEEE | 38.60 | - | |
| 275 | N-linked_Glycosylation | GLQTDKRNITLTTTK CCCCCCCCEEEEECC | 37.02 | - | |
| 309 | N-linked_Glycosylation | ALLAKSLNASYSKTL HHHHHHCCCCCCCEE | 33.65 | - | |
| 328 | N-linked_Glycosylation | YTCPSSDNKTSVAFD EECCCCCCCEEEEEE | 51.99 | - | |
| 367 | N-linked_Glycosylation | AIIPQAGNATAILGD EEECCCCCEEEEECC | 36.81 | - | |
| 422 | N-linked_Glycosylation | AIRAPSYNNTWSNYA CCCCCCCCCCCCCEE | 43.74 | - | |
| 445 | N-linked_Glycosylation | FTTVRTFNGTSTATT EEEEEEECCCCCEEE | 52.82 | - | |
| 462 | N-linked_Glycosylation | STTTKKTNSTTTAKS EECEEECCCCCCCCC | 46.36 | - | |
| 483 | GPI-anchor | ALQRAATNSASSIRS HHHHHHHHCHHHHHH | 30.74 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPS3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPS3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPS3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CND2_YEAST | BRN1 | genetic | 27708008 | |
| KPC1_YEAST | PKC1 | genetic | 27708008 | |
| GPI8_YEAST | GPI8 | genetic | 27708008 | |
| RSP5_YEAST | RSP5 | genetic | 27708008 | |
| PSB7_YEAST | PRE4 | genetic | 27708008 | |
| MOB1_YEAST | MOB1 | genetic | 27708008 | |
| ARP4_YEAST | ARP4 | genetic | 27708008 | |
| FIP1_YEAST | FIP1 | genetic | 27708008 | |
| ORC1_YEAST | ORC1 | genetic | 27708008 | |
| SEC65_YEAST | SEC65 | genetic | 27708008 | |
| NOP2_YEAST | NOP2 | genetic | 27708008 | |
| MVD1_YEAST | MVD1 | genetic | 27708008 | |
| SEC63_YEAST | SEC63 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
