UniProt ID | RPA12_YEAST | |
---|---|---|
UniProt AC | P32529 | |
Protein Name | DNA-directed RNA polymerase I subunit RPA12 | |
Gene Name | RPA12 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 125 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I (Pol I) which synthesizes ribosomal RNA precursors. Besides, RNA polymerase I has intrinsic RNA cleavage activity. Proposed to contribute to the polymerase catalytic activity and form the polymerase active center together with the two largest subunits. Subunit RPA12 contributes a catalytic zinc ribbon that is required for RNA cleavage by Pol I. Involved in transcriptional termination.. | |
Protein Sequence | MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Acetylation | KSQFSNLKVVTTTAD HHHCCCCEEEEEECC | 38.62 | 24489116 | |
58 | Phosphorylation | TADDAFPSSLRAKKS ECCCCCCHHHHHCHH | 35.23 | 27017623 | |
59 | Phosphorylation | ADDAFPSSLRAKKSV CCCCCCHHHHHCHHH | 23.32 | 21440633 | |
103 | Phosphorylation | YHTLQLRSADEGATV EEEEEEEECCCCCEE | 48.98 | 21440633 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPA12_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPA12_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPA12_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-59, AND MASSSPECTROMETRY. |