| UniProt ID | TMC1_YEAST | |
|---|---|---|
| UniProt AC | Q08422 | |
| Protein Name | AN1-type zinc finger protein TMC1 {ECO:0000305} | |
| Gene Name | TMC1 {ECO:0000303|PubMed:24297164} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 150 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May have a role in protecting cells from metalloid-induced proteotoxicity.. | |
| Protein Sequence | MSDINEIEIPSRKDEIRQVTPKDPMHEIEDKSTYHAKIKKSDSGTVLGAIPLNSRSSSNSSVTSTGQSSRRVTKKTTKKKKKNACYFDTCSSAASKFIGDCNFCKGHFCSKHRLMENHACNGLTSCKEQLHQRNADKLEAEQTKAPKIQI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSDINEIEI ------CCCCCCCCC | 22814378 | ||
| 2 | Phosphorylation | ------MSDINEIEI ------CCCCCCCCC | 22369663 | ||
| 11 | Phosphorylation | INEIEIPSRKDEIRQ CCCCCCCCCHHHHCC | 22369663 | ||
| 13 | Acetylation | EIEIPSRKDEIRQVT CCCCCCCHHHHCCCC | 24489116 | ||
| 20 | Phosphorylation | KDEIRQVTPKDPMHE HHHHCCCCCCCCCCC | 19823750 | ||
| 41 | Phosphorylation | YHAKIKKSDSGTVLG EEEEEEECCCCCEEE | 22369663 | ||
| 43 | Phosphorylation | AKIKKSDSGTVLGAI EEEEECCCCCEEEEE | 22369663 | ||
| 45 | Phosphorylation | IKKSDSGTVLGAIPL EEECCCCCEEEEEEC | 22369663 | ||
| 54 | Phosphorylation | LGAIPLNSRSSSNSS EEEEECCCCCCCCCC | 22369663 | ||
| 56 | Phosphorylation | AIPLNSRSSSNSSVT EEECCCCCCCCCCCC | 22890988 | ||
| 57 | Phosphorylation | IPLNSRSSSNSSVTS EECCCCCCCCCCCCC | 22890988 | ||
| 58 | Phosphorylation | PLNSRSSSNSSVTST ECCCCCCCCCCCCCC | 22369663 | ||
| 60 | Phosphorylation | NSRSSSNSSVTSTGQ CCCCCCCCCCCCCCH | 22890988 | ||
| 61 | Phosphorylation | SRSSSNSSVTSTGQS CCCCCCCCCCCCCHH | 22369663 | ||
| 63 | Phosphorylation | SSSNSSVTSTGQSSR CCCCCCCCCCCHHHC | 22890988 | ||
| 64 | Phosphorylation | SSNSSVTSTGQSSRR CCCCCCCCCCHHHCC | 22890988 | ||
| 65 | Phosphorylation | SNSSVTSTGQSSRRV CCCCCCCCCHHHCCC | 22890988 | ||
| 68 | Phosphorylation | SVTSTGQSSRRVTKK CCCCCCHHHCCCCCC | 22890988 | ||
| 69 | Phosphorylation | VTSTGQSSRRVTKKT CCCCCHHHCCCCCCC | 22890988 | ||
| 73 | Phosphorylation | GQSSRRVTKKTTKKK CHHHCCCCCCCCCCC | 19795423 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMC1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMC1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...