| UniProt ID | TOS8_YEAST | |
|---|---|---|
| UniProt AC | P53147 | |
| Protein Name | Homeobox protein TOS8 | |
| Gene Name | TOS8 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 276 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MGTSIVNLNQKIELPPIQVLFESLNRENETKPHFEERRLYQPNPSFVPRTNIAVGSPVNPVPVSSPVFFIGPSPQRSIQNHNAIMTQNIRQYPVIYNNNREVISTGERNYIITVGGPPVTSSQPEYEHISTPNFYQEQRLAQPHPVNESMMIGGYTNPQPISISRGKMLSGNISTNSVRGSNNGYSAKEKKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRKIFSGQNDANNFRRKFSSSTNLAKF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MGTSIVNLNQ -----CCCCCCCCCC | 17.62 | 22369663 | |
| 4 | Phosphorylation | ----MGTSIVNLNQK ----CCCCCCCCCCC | 20.86 | 22369663 | |
| 268 | Phosphorylation | NNFRRKFSSSTNLAK HHHHHHHHCCCCCCC | 26.81 | 28889911 | |
| 269 | Phosphorylation | NFRRKFSSSTNLAKF HHHHHHHCCCCCCCC | 44.29 | 21440633 | |
| 270 | Phosphorylation | FRRKFSSSTNLAKF- HHHHHHCCCCCCCC- | 21.81 | 24961812 | |
| 271 | Phosphorylation | RRKFSSSTNLAKF-- HHHHHCCCCCCCC-- | 35.88 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOS8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOS8_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOS8_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HSH49_YEAST | HSH49 | physical | 10688190 | |
| GLN3_YEAST | GLN3 | genetic | 20959818 | |
| KCS1_YEAST | KCS1 | genetic | 21127252 | |
| HAL4_YEAST | SAT4 | genetic | 21127252 | |
| PYC2_YEAST | PYC2 | genetic | 27708008 | |
| ARO1_YEAST | ARO1 | genetic | 27708008 | |
| LSB1_YEAST | LSB1 | genetic | 27708008 | |
| ECM12_YEAST | ECM12 | genetic | 27708008 | |
| BZZ1_YEAST | BZZ1 | genetic | 27708008 | |
| ELM1_YEAST | ELM1 | genetic | 27708008 | |
| PRY2_YEAST | PRY2 | genetic | 27708008 | |
| PDC1_YEAST | PDC1 | genetic | 27708008 | |
| YL283_YEAST | YLR283W | genetic | 27708008 | |
| STE23_YEAST | STE23 | genetic | 27708008 | |
| YL413_YEAST | INA1 | genetic | 27708008 | |
| YM59_YEAST | YMR209C | genetic | 27708008 | |
| TPM1_YEAST | TPM1 | genetic | 27708008 | |
| SIN3_YEAST | SIN3 | genetic | 27708008 | |
| CYC2_YEAST | CYC2 | genetic | 27708008 | |
| SUCA_YEAST | LSC1 | genetic | 27708008 | |
| RS28A_YEAST | RPS28A | genetic | 27708008 | |
| ALDH4_YEAST | ALD4 | genetic | 27708008 | |
| KA120_YEAST | KAP120 | genetic | 27708008 | |
| ALG5_YEAST | ALG5 | genetic | 27708008 | |
| YP089_YEAST | YPR089W | genetic | 27708008 | |
| MET16_YEAST | MET16 | genetic | 27708008 | |
| HDA3_YEAST | HDA3 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...