ECM12_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ECM12_YEAST
• UniProt AC: O13529
• Protein Name: Protein ECM12
• Gene Name: ECM12
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 151
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: May be involved in cell wall organization and biogenesis..
• Protein Sequence: MNRSFHFLIKYIYIHVLLVFYFHIKQQAIMPFFIFFFSSFDGLSFDLRVVAFLAKHVFVGVCSPFFVVGFFGSSRVVVTEWLSKLVLPPPPVSITQVFSLSRKRGEFSSGYILIINPYKSFLRSLLDFSIFNNTAKNKSSTFTLNLEDVSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	N-linked_Glycosylation	------MNRSFHFLI ------CCCCHHHHH	48.59	-
132	N-linked_Glycosylation	LLDFSIFNNTAKNKS HHCHHHHCCCCCCCC	43.18	-
137	N-linked_Glycosylation	IFNNTAKNKSSTFTL HHCCCCCCCCCEEEE	47.15	-
141	Phosphorylation	TAKNKSSTFTLNLED CCCCCCCEEEEEHHH	27.94	27017623
143	Phosphorylation	KNKSSTFTLNLEDVS CCCCCEEEEEHHHHC	18.15	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ECM12_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ECM12_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ECM12_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BPH1_YEAST	BPH1	genetic	23891562

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.