YO238_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YO238_YEAST
• UniProt AC: Q08634
• Protein Name: Uncharacterized protein YOR238W
• Gene Name: YOR238W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 303
• Subcellular Localization: Cytoplasm .
• Protein Sequence: MDEKVELILVPCHSIWKSSSHPSDNSVNLGQLPEYWHLAPFQYEGNDHLAFIKHGLTAIKLLLQRFDTATVIFSGSQTKKEAGAISEAQSYYFLFEKLIRYVMSNDNIDVPNFDNELRLLLKEVKNLLSSQNVNVDELFYGGSITTEEFSLDSFDNLIYSIYRFEEVNKKFPQKITIIGFAFKMPRFISCHAKAIDYPQSNITYIGIDPKPANYNQTQLSKYYDDLVQMEDKNALSLFSSDWYATKDRLLTKKRSRNPFNRTAPYAQNIFCKENGKRIEGIEDDEEYFETKIKCKMPWSSPRQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	Ubiquitination	IFSGSQTKKEAGAIS EEECCCCHHHHCCCC	40.76	19722269
80	Ubiquitination	FSGSQTKKEAGAISE EECCCCHHHHCCCCH	57.07	19722269
90	Phosphorylation	GAISEAQSYYFLFEK CCCCHHHHHHHHHHH	28.93	28152593
92	Phosphorylation	ISEAQSYYFLFEKLI CCHHHHHHHHHHHHH	10.07	28152593
122	Acetylation	NELRLLLKEVKNLLS HHHHHHHHHHHHHHH	61.50	25381059
299	Phosphorylation	IKCKMPWSSPRQ--- EEECCCCCCCCC---	25.29	22369663
300	Phosphorylation	KCKMPWSSPRQ---- EECCCCCCCCC----	21.89	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YO238_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YO238_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YO238_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LIN1_YEAST	LIN1	physical	16554755

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.