dbPTM

LOT5_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LOT5_YEAST
UniProt AC	P34234
Protein Name	Protein LOT5
Gene Name	LOT5
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	306
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description
Protein Sequence	MMKKKPKCQIARTKPSVENVIPYNQFKKTQPRFNGNFSALNNEEYIILFGGGRDLILGSLTPCSSSHLSNQANPQDTSEYGTDLFILNSCIIIWFNGLGYGLEIPYSSVLYHASRRLPDGREGLQLEILLTLERDEVLDMLYQSLAPQACEFDGEEAHAFTVRSVELTIRPKYSIYDRHYNNEIETLFTFENFGVNRGDDLVNNCNEALAVCMDLHGEDVQDQDQEQYQDPSMAFEGAQDLNATYSGLGDTLHGPPVYQNDGLADDLDGDLVMDNVVSRGGPEASMSMEFYANQNLAGRKNSRDNE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of LOT5_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LOT5_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LOT5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LOT5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAD3_YEAST	TAD3	genetic	19061648
NCBP2_YEAST	CBC2	genetic	19061648
ELP1_YEAST	IKI3	genetic	19061648
HMT1_YEAST	HMT1	genetic	19061648
EF1A_YEAST	TEF2	genetic	19061648

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LOT5_YEAST

Related Literatures of Post-Translational Modification