UniProt ID | CWC25_YEAST | |
---|---|---|
UniProt AC | P53854 | |
Protein Name | Pre-mRNA-splicing factor CWC25 | |
Gene Name | CWC25 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 179 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in pre-mRNA splicing.. | |
Protein Sequence | MGSGDLNLLKSWNPKLMKNRKKVWETEQDLITEQQKLNTRLKEIEKERELNELLNESSKDKPETLKNDLALKKSGLEWMYQDAKLSDEKEDYLLGKKKLDSSILNQPATPPVRAATTISASGAATSISSQKKKSKLLKDDPMSKFKVTKQQRRTPDSTKKRAMSQRGKPLSKPAPDLDY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
72 | Acetylation | LKNDLALKKSGLEWM HHHHHHHHHHCCHHH | 39.01 | 25381059 | |
86 | Phosphorylation | MYQDAKLSDEKEDYL HHHCCCCCHHHHHHH | 42.91 | 27017623 | |
92 | Phosphorylation | LSDEKEDYLLGKKKL CCHHHHHHHCCCHHC | 12.62 | 27017623 | |
96 | Acetylation | KEDYLLGKKKLDSSI HHHHHCCCHHCCHHH | 46.86 | 25381059 | |
101 | Phosphorylation | LGKKKLDSSILNQPA CCCHHCCHHHHCCCC | 29.70 | 28132839 | |
102 | Phosphorylation | GKKKLDSSILNQPAT CCHHCCHHHHCCCCC | 30.66 | 28132839 | |
109 | Phosphorylation | SILNQPATPPVRAAT HHHCCCCCCCCCHHE | 34.50 | 22369663 | |
116 | Phosphorylation | TPPVRAATTISASGA CCCCCHHEEEECCCC | 24.55 | 21126336 | |
117 | Phosphorylation | PPVRAATTISASGAA CCCCHHEEEECCCCC | 14.28 | 27214570 | |
125 | Phosphorylation | ISASGAATSISSQKK EECCCCCCCCCCHHH | 26.51 | 21082442 | |
129 | Phosphorylation | GAATSISSQKKKSKL CCCCCCCCHHHHHHH | 44.33 | 27214570 | |
138 | Acetylation | KKKSKLLKDDPMSKF HHHHHHCCCCCCHHH | 71.21 | 25381059 | |
144 | Acetylation | LKDDPMSKFKVTKQQ CCCCCCHHHCCCCHH | 42.84 | 24489116 | |
172 | Acetylation | QRGKPLSKPAPDLDY HCCCCCCCCCCCCCC | 53.53 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWC25_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWC25_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWC25_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...