UniProt ID | DDR2_YEAST | |
---|---|---|
UniProt AC | P89113 | |
Protein Name | Protein DDR2 | |
Gene Name | DDR2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 61 | |
Subcellular Localization | ||
Protein Description | May play an important role in the response of cells to diverse environmental stresses.. | |
Protein Sequence | MKVSQVFISAISVFGLATSVNAQNASNTTSNAAPALHAQNGQLLNAGVVGAAVGGALAFLI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DDR2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DDR2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DDR2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SAC7_YEAST | SAC7 | genetic | 23891562 | |
CSG2_YEAST | CSG2 | genetic | 23891562 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
BUD31_YEAST | BUD31 | genetic | 27708008 | |
XRN1_YEAST | XRN1 | genetic | 27708008 | |
RTG2_YEAST | RTG2 | genetic | 27708008 | |
RPB1_YEAST | RPO21 | genetic | 27708008 | |
TFB1_YEAST | TFB1 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
CDC25_YEAST | CDC25 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
DCP2_YEAST | DCP2 | genetic | 27708008 | |
SEC12_YEAST | SEC12 | genetic | 27708008 | |
NAB3_YEAST | NAB3 | genetic | 27708008 | |
ATC3_YEAST | DRS2 | genetic | 27708008 | |
INO2_YEAST | INO2 | genetic | 27708008 | |
H2A1_YEAST | HTA1 | genetic | 27708008 | |
OMS1_YEAST | OMS1 | genetic | 27708008 | |
PALF_YEAST | RIM8 | genetic | 27708008 | |
ATC1_YEAST | PMR1 | genetic | 27708008 | |
MDM34_YEAST | MDM34 | genetic | 27708008 | |
HXKB_YEAST | HXK2 | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
PHB2_YEAST | PHB2 | genetic | 27708008 | |
IRE1_YEAST | IRE1 | genetic | 27708008 | |
VPS24_YEAST | VPS24 | genetic | 27708008 | |
ELM1_YEAST | ELM1 | genetic | 27708008 | |
MIC60_YEAST | MIC60 | genetic | 27708008 | |
MMR1_YEAST | MMR1 | genetic | 27708008 | |
HSP7F_YEAST | SSE1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...