SWT21_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SWT21_YEAST
• UniProt AC: P53873
• Protein Name: Protein SWT21
• Gene Name: SWT21
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 357
• Subcellular Localization: Nucleus .
• Protein Description: Involved in mRNA splicing. Helps to stabilize the U1 snRNP-5' splice site interaction..
• Protein Sequence: MEKKVICQDIFWSCDGTSFVSVHNDFGIRQYLVPEESNTDKLNRNLLLPFTRFFRNQSIVSCAIDPFYTLYNENSDRLAGDRIVVGGKNFPLQLYSLMDGQCILSYDTMNKINGEYETVYSVKIDVESRVYTGSCRNKVAIYDKSRRDAVWMNQSTKKASKGRQSIISCFEEQPMGGQALSRGSLLCGSYANEMFQVDCRHQRLERLNYTRTVAGGIVQILTSDNGRYVYVVRRNSDAISIYDRRNLQHELNVLRLPFRIHHNSAKLKAYIDTAYGLSMGTPQGTILNWGRDLVEFGGVPSHNSVEDPLITSIPPESEWRTNLDSTIPATVVKNCPGDPELFALSHGGTISLCRFGG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SWT21_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SWT21_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SWT21_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SWT21_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HMO1_YEAST	HMO1	genetic	20093466
SSD1_YEAST	SSD1	genetic	20093466
MUD2_YEAST	MUD2	genetic	20093466
NCBP2_YEAST	CBC2	genetic	20093466
TGS1_YEAST	TGS1	genetic	20093466

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.