UniProt ID | PNPP_YEAST | |
---|---|---|
UniProt AC | P19881 | |
Protein Name | 4-nitrophenylphosphatase | |
Gene Name | PHO13 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 312 | |
Subcellular Localization | ||
Protein Description | PHO13 is dispensable for vegetative growth and sporulation.. | |
Protein Sequence | MTAQQGVPIKITNKEIAQEFLDKYDTFLFDCDGVLWLGSQALPYTLEILNLLKQLGKQLIFVTNNSTKSRLAYTKKFASFGIDVKEEQIFTSGYASAVYIRDFLKLQPGKDKVWVFGESGIGEELKLMGYESLGGADSRLDTPFDAAKSPFLVNGLDKDVSCVIAGLDTKVNYHRLAVTLQYLQKDSVHFVGTNVDSTFPQKGYTFPGAGSMIESLAFSSNRRPSYCGKPNQNMLNSIISAFNLDRSKCCMVGDRLNTDMKFGVEGGLGGTLLVLSGIETEERALKISHDYPRPKFYIDKLGDIYTLTNNEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 | Phosphorylation | GKQLIFVTNNSTKSR CCCEEEEECCCCCCC | 20.24 | 24909858 | |
66 | Phosphorylation | LIFVTNNSTKSRLAY EEEEECCCCCCCHHE | 39.00 | 24909858 | |
67 | Phosphorylation | IFVTNNSTKSRLAYT EEEECCCCCCCHHEE | 34.85 | 24909858 | |
119 | Phosphorylation | KVWVFGESGIGEELK EEEEEECCCCCHHHH | 35.77 | 30377154 | |
126 | Ubiquitination | SGIGEELKLMGYESL CCCCHHHHHCCEECC | 39.44 | 18433149 | |
130 | Phosphorylation | EELKLMGYESLGGAD HHHHHCCEECCCCCC | 6.59 | 28889911 | |
148 | Acetylation | DTPFDAAKSPFLVNG CCCCHHHCCCCCCCC | 61.45 | 24489116 | |
187 | Phosphorylation | LQYLQKDSVHFVGTN HHHHHHCCEEEEECC | 25.24 | 26447709 | |
193 | Phosphorylation | DSVHFVGTNVDSTFP CCEEEEECCCCCCCC | 27.11 | 27717283 | |
197 | Phosphorylation | FVGTNVDSTFPQKGY EEECCCCCCCCCCCC | 27.89 | 22369663 | |
198 | Phosphorylation | VGTNVDSTFPQKGYT EECCCCCCCCCCCCC | 34.57 | 22369663 | |
204 | Phosphorylation | STFPQKGYTFPGAGS CCCCCCCCCCCCCCH | 16.55 | 30377154 | |
205 | Phosphorylation | TFPQKGYTFPGAGSM CCCCCCCCCCCCCHH | 31.83 | 30377154 | |
211 | Phosphorylation | YTFPGAGSMIESLAF CCCCCCCHHHHHHHC | 18.95 | 30377154 | |
215 | Phosphorylation | GAGSMIESLAFSSNR CCCHHHHHHHCCCCC | 17.67 | 30377154 | |
225 | Phosphorylation | FSSNRRPSYCGKPNQ CCCCCCCCCCCCCCH | 31.10 | 28889911 | |
240 | Phosphorylation | NMLNSIISAFNLDRS HHHHHHHHHHCCCHH | 25.74 | 21551504 | |
295 | Acetylation | SHDYPRPKFYIDKLG CCCCCCCCEEECCCC | 52.67 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PNPP_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PNPP_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PNPP_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-197, AND MASSSPECTROMETRY. | |
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-198, AND MASSSPECTROMETRY. |