| UniProt ID | PGA2_YEAST | |
|---|---|---|
| UniProt AC | P53903 | |
| Protein Name | Processing of GAS1 and ALP protein 2 | |
| Gene Name | PGA2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 129 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . Nucleus membrane Single-pass membrane protein . |
|
| Protein Description | Involved in the processing and trafficking of GAS1 and PHO8 glycosylated proteins.. | |
| Protein Sequence | MSEVAETWVDTWMAKLVNYDYKHFIRLVIIVGGYLLLRNIASRELAKKQLAAQVEKDKRDKEEKRSKDLIDKPDDAATAETTSFGWGKKTRRRVKRQQELFENALEEAKRRNQGLDPDSDADIEELLEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSEVAETWV ------CCHHHHHHH | 40.55 | - | |
| 2 | Phosphorylation | ------MSEVAETWV ------CCHHHHHHH | 40.55 | 21126336 | |
| 7 | Phosphorylation | -MSEVAETWVDTWMA -CCHHHHHHHHHHHH | 22.50 | 28132839 | |
| 11 | Phosphorylation | VAETWVDTWMAKLVN HHHHHHHHHHHHHCC | 13.92 | 28132839 | |
| 19 | Phosphorylation | WMAKLVNYDYKHFIR HHHHHCCCCHHHHHH | 17.11 | 28132839 | |
| 21 | Phosphorylation | AKLVNYDYKHFIRLV HHHCCCCHHHHHHHH | 8.94 | 28132839 | |
| 66 | Phosphorylation | RDKEEKRSKDLIDKP HHHHHHHHHHHCCCC | 41.40 | 27214570 | |
| 67 | Acetylation | DKEEKRSKDLIDKPD HHHHHHHHHHCCCCC | 61.66 | 24489116 | |
| 72 | Acetylation | RSKDLIDKPDDAATA HHHHHCCCCCCCCCH | 43.27 | 24489116 | |
| 78 | Phosphorylation | DKPDDAATAETTSFG CCCCCCCCHHHCCCC | 27.09 | 25521595 | |
| 81 | Phosphorylation | DDAATAETTSFGWGK CCCCCHHHCCCCCCH | 25.85 | 21440633 | |
| 82 | Phosphorylation | DAATAETTSFGWGKK CCCCHHHCCCCCCHH | 17.35 | 25521595 | |
| 83 | Phosphorylation | AATAETTSFGWGKKT CCCHHHCCCCCCHHH | 29.22 | 25521595 | |
| 109 | Acetylation | ENALEEAKRRNQGLD HHHHHHHHHHHCCCC | 55.99 | 24489116 | |
| 119 | Phosphorylation | NQGLDPDSDADIEEL HCCCCCCCCCCHHHH | 39.83 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGA2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGA2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGA2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-119, AND MASSSPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-119, AND MASSSPECTROMETRY. | |
