| UniProt ID | GSP2_YEAST | |
|---|---|---|
| UniProt AC | P32836 | |
| Protein Name | GTP-binding nuclear protein GSP2/CNR2 | |
| Gene Name | GSP2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 220 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Not essential for cell viability.. | |
| Protein Sequence | MSAPAQNNAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMHQYQQEMDQATALPLPDEDDADL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSAPAQNNA ------CCCCCCCCC | 42.85 | - | |
| 2 | Phosphorylation | ------MSAPAQNNA ------CCCCCCCCC | 42.85 | 28889911 | |
| 13 | Phosphorylation | QNNAEVPTFKLVLVG CCCCCCCEEEEEEEE | 38.28 | 30377154 | |
| 15 | Ubiquitination | NAEVPTFKLVLVGDG CCCCCEEEEEEEECC | 39.92 | 15699485 | |
| 26 | Ubiquitination | VGDGGTGKTTFVKRH EECCCCCCCEEEEEH | 44.20 | 15699485 | |
| 35 | Phosphorylation | TFVKRHLTGEFEKKY EEEEEHHCCCCEEEE | 28.65 | 27214570 | |
| 102 | Ubiquitination | VTSRITYKNVPNWHR CCCCCEECCCCCHHH | 42.70 | 23749301 | |
| 126 | Ubiquitination | PIVLCGNKVDVKERK CEEECCCCCCCCCCE | 25.70 | 23749301 | |
| 130 | Ubiquitination | CGNKVDVKERKVKAK CCCCCCCCCCEEECE | 47.54 | 22817900 | |
| 133 | Ubiquitination | KVDVKERKVKAKTIT CCCCCCCEEECEEEE | 49.53 | 22817900 | |
| 135 | Ubiquitination | DVKERKVKAKTITFH CCCCCEEECEEEEEE | 47.39 | 22817900 | |
| 137 | Ubiquitination | KERKVKAKTITFHRK CCCEEECEEEEEEEC | 34.44 | 22817900 | |
| 138 | Phosphorylation | ERKVKAKTITFHRKK CCEEECEEEEEEECC | 30.06 | 28889911 | |
| 155 | Ubiquitination | QYYDISAKSNYNFEK EEEEEECCCCCCCCC | 32.23 | 24961812 | |
| 156 | Phosphorylation | YYDISAKSNYNFEKP EEEEECCCCCCCCCH | 44.24 | 21440633 | |
| 182 | Phosphorylation | PQLEFVASPALAPPE CCEEEEECCCCCCCC | 12.85 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSP2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSP2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSP2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
