| UniProt ID | NTF2_YEAST | |
|---|---|---|
| UniProt AC | P33331 | |
| Protein Name | Nuclear transport factor 2 | |
| Gene Name | NTF2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 125 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Facilitates protein transport into the nucleus. Interacts with various nucleoporins and with Ran-GDP. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import. In vitro, the NTF2-Ran-GDP association, in the presence of GTP, triggers dissociation of the karyopherin alpha-beta complex, allowing nuclear translocation of karyopherin alpha and the NLS substrate.. | |
| Protein Sequence | MSLDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFRLNYSA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSLDFNTLA ------CCCCHHHHH | 36.32 | 22814378 | |
| 35 | Phosphorylation | GNLYRNESMLTFETS HHHHCCCCCEEEEHH | 23.73 | 27017623 | |
| 42 | Phosphorylation | SMLTFETSQLQGAKD CCEEEEHHHCCCCHH | 22.99 | 27017623 | |
| 48 | Ubiquitination | TSQLQGAKDIVEKLV HHHCCCCHHHHHHHH | 55.61 | 23749301 | |
| 48 | Acetylation | TSQLQGAKDIVEKLV HHHCCCCHHHHHHHH | 55.61 | 24489116 | |
| 53 | Ubiquitination | GAKDIVEKLVSLPFQ CCHHHHHHHHCCCHH | 43.21 | 23749301 | |
| 53 | Acetylation | GAKDIVEKLVSLPFQ CCHHHHHHHHCCCHH | 43.21 | 24489116 | |
| 61 | Acetylation | LVSLPFQKVQHRITT HHCCCHHHCEEEEEE | 44.21 | 24489116 | |
| 61 | 2-Hydroxyisobutyrylation | LVSLPFQKVQHRITT HHCCCHHHCEEEEEE | 44.21 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NTF2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NTF2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NTF2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
