UniProt ID | YP108_YEAST | |
---|---|---|
UniProt AC | Q02872 | |
Protein Name | Uncharacterized protein YPL108W | |
Gene Name | YPL108W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 168 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MKEASDREEAPKMVEKNYSTGFRKAHGEKDQSVTKPISLDGRTGEVIVRKSTGKTKIRKGQTEEEYTQQLQHYFEVEQGPVRTKVGWMDEVDPLVEIREGKYDISNKHQRQVLSGFCHRLFYQCKYKECLDLSTYFLGLFEPFNVKNKMKRELEELEYMIERCRGHVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Phosphorylation | QSVTKPISLDGRTGE CCCCCCEEECCCCCE | 29.00 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP108_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP108_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP108_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DUS4_YEAST | DUS4 | physical | 18719252 | |
HSP71_YEAST | SSA1 | physical | 19536198 | |
RPN11_YEAST | RPN11 | genetic | 27708008 | |
SMD1_YEAST | SMD1 | genetic | 27708008 | |
BIG1_YEAST | BIG1 | genetic | 27708008 | |
NU192_YEAST | NUP192 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
ROT1_YEAST | ROT1 | genetic | 27708008 | |
NSL1_YEAST | NSL1 | genetic | 27708008 | |
PYRG2_HUMAN | CTPS2 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...