YP108_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YP108_YEAST
• UniProt AC: Q02872
• Protein Name: Uncharacterized protein YPL108W
• Gene Name: YPL108W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 168
• Subcellular Localization: Cytoplasm .
• Protein Sequence: MKEASDREEAPKMVEKNYSTGFRKAHGEKDQSVTKPISLDGRTGEVIVRKSTGKTKIRKGQTEEEYTQQLQHYFEVEQGPVRTKVGWMDEVDPLVEIREGKYDISNKHQRQVLSGFCHRLFYQCKYKECLDLSTYFLGLFEPFNVKNKMKRELEELEYMIERCRGHVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Phosphorylation	QSVTKPISLDGRTGE CCCCCCEEECCCCCE	29.00	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YP108_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YP108_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YP108_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DUS4_YEAST	DUS4	physical	18719252
HSP71_YEAST	SSA1	physical	19536198
RPN11_YEAST	RPN11	genetic	27708008
SMD1_YEAST	SMD1	genetic	27708008
BIG1_YEAST	BIG1	genetic	27708008
NU192_YEAST	NUP192	genetic	27708008
KTHY_YEAST	CDC8	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
ROT1_YEAST	ROT1	genetic	27708008
NSL1_YEAST	NSL1	genetic	27708008
PYRG2_HUMAN	CTPS2	physical	27107014

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.