| UniProt ID | RISA_YEAST | |
|---|---|---|
| UniProt AC | P38145 | |
| Protein Name | Riboflavin synthase | |
| Gene Name | RIB5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 238 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes the dismutation of two molecules of 6,7-dimethyl-8-ribityllumazine, resulting in the formation of riboflavin and 5-amino-6-(D-ribitylamino)uracil.. | |
| Protein Sequence | MFTGIVECMGTVLENNPYDDSESGGQGVSITIGNAGSILTDCHVGDSIAVNGVCLTVTEFNNDSFKVGISPETIKRSNVASWIQGTQVNLERAVSQDVRFGGHYVQGHVDTVANIVSRRPEGNSIIFGFQLRDQEYFKYIVEKGFICIDGTSLTIIKVDPLSQGGAFYISMIKHTQDNVIMPLKKIGDEVNIEVDLTGKIIEKQILLTLENQISKKDSTLNTMISNIIEEKVRNYLNK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Ubiquitination | GISPETIKRSNVASW ECCHHHHHHCCHHHH | 58.14 | 23749301 | |
| 95 | Phosphorylation | VNLERAVSQDVRFGG CCHHHHHCCCCEECC | 21.48 | 28889911 | |
| 138 | Acetylation | LRDQEYFKYIVEKGF ECCHHHHHHHHHCCE | 32.92 | 24489116 | |
| 231 | Ubiquitination | ISNIIEEKVRNYLNK HHHHHHHHHHHHHCC | 33.43 | 24961812 | |
| 231 | Acetylation | ISNIIEEKVRNYLNK HHHHHHHHHHHHHCC | 33.43 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RISA_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RISA_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RISA_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-95, AND MASSSPECTROMETRY. | |
