| UniProt ID | RIB4_YEAST | |
|---|---|---|
| UniProt AC | P50861 | |
| Protein Name | 6,7-dimethyl-8-ribityllumazine synthase | |
| Gene Name | RIB4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 169 | |
| Subcellular Localization | Mitochondrion intermembrane space . | |
| Protein Description | Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin.. | |
| Protein Sequence | MAVKGLGKPDQVYDGSKIRVGIIHARWNRVIIDALVKGAIERMASLGVEENNIIIETVPGSYELPWGTKRFVDRQAKLGKPLDVVIPIGVLIKGSTMHFEYISDSTTHALMNLQEKVDMPVIFGLLTCMTEEQALARAGIDEAHSMHNHGEDWGAAAVEMAVKFGKNAF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Acetylation | MAVKGLGKPDQVYDG CCCCCCCCCCCEECC | 50.92 | 25381059 | |
| 17 | Acetylation | DQVYDGSKIRVGIIH CCEECCCEEEEEEEE | 39.81 | 24489116 | |
| 69 | Ubiquitination | YELPWGTKRFVDRQA EECCCCCHHHHHCHH | 39.64 | 24961812 | |
| 80 | Ubiquitination | DRQAKLGKPLDVVIP HCHHHHCCCCEEEEE | 53.49 | 24961812 | |
| 80 | Acetylation | DRQAKLGKPLDVVIP HCHHHHCCCCEEEEE | 53.49 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIB4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIB4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIB4_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RIB4_YEAST | RIB4 | physical | 18719252 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...