dbPTM

YD003_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YD003_YEAST
UniProt AC	Q3E7Z7
Protein Name	Uncharacterized protein YDR003W-A
Gene Name	YDR003W-A
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	40
Subcellular Localization
Protein Description
Protein Sequence	MTCGIENSYKSAEKKKKYRSFRFFESRDYSELCIIVGTYY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
26	Phosphorylation	RSFRFFESRDYSELC CCCCHHHCCCHHHEE	25.87	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YD003_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YD003_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YD003_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GMC1_YEAST	GMC1	genetic	27708008
PUS5_YEAST	PUS5	genetic	27708008
SYF1_YEAST	SYF1	genetic	27708008
RSP5_YEAST	RSP5	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
NBP35_YEAST	NBP35	genetic	27708008
MPPA_YEAST	MAS2	genetic	27708008
KTHY_YEAST	CDC8	genetic	27708008
YJ9I_YEAST	YJR141W	genetic	27708008
FNTA_YEAST	RAM2	genetic	27708008
PRP16_YEAST	PRP16	genetic	27708008
SSL1_YEAST	SSL1	genetic	27708008
ORC1_YEAST	ORC1	genetic	27708008
ERO1_YEAST	ERO1	genetic	27708008
MED11_YEAST	MED11	genetic	27708008
PROF_YEAST	PFY1	genetic	27708008
NIP7_YEAST	NIP7	genetic	27708008
IES1_YEAST	IES1	genetic	27708008
MED5_YEAST	NUT1	genetic	27708008
ATC1_YEAST	PMR1	genetic	27708008
SLT2_YEAST	SLT2	genetic	27708008
VPS53_YEAST	VPS53	genetic	27708008
SNX4_YEAST	SNX4	genetic	27708008
ASF1_YEAST	ASF1	genetic	27708008
SWE1_YEAST	SWE1	genetic	27708008
ELM1_YEAST	ELM1	genetic	27708008
UBI4P_YEAST	UBI4	genetic	27708008
RL22A_YEAST	RPL22A	genetic	27708008
RNH2A_YEAST	RNH201	genetic	27708008
PHO23_YEAST	PHO23	genetic	27708008
SIN3_YEAST	SIN3	genetic	27708008
VAM10_YEAST	VAM10	genetic	27708008
GYP1_YEAST	GYP1	genetic	27708008
PDE2_YEAST	PDE2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YD003_YEAST

Related Literatures of Post-Translational Modification