| UniProt ID | BUD23_YEAST | |
|---|---|---|
| UniProt AC | P25627 | |
| Protein Name | 18S rRNA (guanine(1575)-N(7))-methyltransferase | |
| Gene Name | BUD23 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 275 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the N(7) position of guanine 1575 (m7G1575) in 18S rRNA. Requires the methyltransferase adapter protein TRM112 for full rRNA methyltransferase activity. Important for biogenesis end export of the 40S ribosomal subunit independent on its methyltransferase activity. Required for efficient cleavage of the primary 35S precursor rRNA at site A2. Involved in positioning the proximal bud pole signal.. | |
| Protein Sequence | MSRPEELAPPEIFYNDSEAHKYTGSTRVQHIQAKMTLRALELLNLQPCSFILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLATGLSRELEGDLMLQDMGTGIPFRAGSFDAAISISAIQWLCNADTSYNDPKQRLMRFFNTLYAALKKGGKFVAQFYPKNDDQVDDILQSAKVAGFSGGLVVDDPESKKNKKYYLVLSSGAPPQGEEQVNLDGVTMDEENVNLKKQLRQRLKGGKDKESAKSFILRKKELMKRRGRKVAKDSKFTGRKRRHRF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | LAPPEIFYNDSEAHK HCCCCCCCCCCHHHH | 24.58 | 24961812 | |
| 17 | Phosphorylation | PEIFYNDSEAHKYTG CCCCCCCCHHHHCCC | 32.80 | 24961812 | |
| 21 | Acetylation | YNDSEAHKYTGSTRV CCCCHHHHCCCCCCH | 52.10 | 24489116 | |
| 161 | Acetylation | FVAQFYPKNDDQVDD EEEEECCCCCHHHHH | 62.72 | 24489116 | |
| 237 | Acetylation | RQRLKGGKDKESAKS HHHHCCCCCHHHHHH | 74.44 | 25381059 | |
| 243 | Acetylation | GKDKESAKSFILRKK CCCHHHHHHHHHHHH | 56.00 | 25381059 | |
| 244 | Phosphorylation | KDKESAKSFILRKKE CCHHHHHHHHHHHHH | 19.75 | 28889911 | |
| 265 | Acetylation | RKVAKDSKFTGRKRR CHHHCCCCCCCCCCC | 58.01 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BUD23_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BUD23_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BUD23_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
