UniProt ID | TR112_YEAST | |
---|---|---|
UniProt AC | P53738 | |
Protein Name | Multifunctional methyltransferase subunit TRM112 | |
Gene Name | TRM112 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 135 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Acts as an activator of both rRNA/tRNA and protein methyltransferases. Together with methyltransferase MTQ2, required for the methylation of eRF1 on 'Gln-182'. Together with methyltransferase TRM11, required for the formation of 2-methylguanosine at position 10 (m2G10) in tRNA. Together with methyltransferase BUD23, required for the formation of 7-methylguanine at position 1575 (m7G1575) in 18S rRNA. Involved in biogenesis of both 40S and 60S ribosomal subunits.. | |
Protein Sequence | MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Ubiquitination | ------MKFLTTNFL ------CCCCHHHCE | 49.43 | 23749301 | |
10 | Acetylation | FLTTNFLKCSVKACD CCHHHCEEEEEEECC | 21.96 | 24489116 | |
18 | Phosphorylation | CSVKACDTSNDNFPL EEEEECCCCCCCCCC | 29.34 | 28132839 | |
19 | Phosphorylation | SVKACDTSNDNFPLQ EEEECCCCCCCCCCE | 29.00 | 28132839 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TR112_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TR112_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TR112_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...