MTQ2_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MTQ2_YEAST
• UniProt AC: Q03920
• Protein Name: eRF1 methyltransferase catalytic subunit MTQ2
• Gene Name: MTQ2
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 221
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Methylates eRF1 on 'Gln-182' using S-adenosyl L-methionine as methyl donor. eRF1 needs to be complexed to eRF3 in its GTP-bound form to be efficiently methylated..
• Protein Sequence: MLPTPYVKCDYDKVYEPAEDSFLILDCLEKEHDFLKQKFGNRLAIVCEIGSGSGIVTTFLMQNKIIPQENSIHLAVDINPWALEATLDTAKLNSCKSSFLEVIQADLNSSIRNNQVDVLIFNPPYVPAECVPDVPGSREEADQWLDLALLGGKDGMAITDKLLRQLEQILSPDGVAYILFCARNKPKEVIKRFVDTYKWNVKLIETRKAGWEVLSVYSFTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
161	Acetylation	DGMAITDKLLRQLEQ CHHHHHHHHHHHHHH	40.55	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MTQ2_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MTQ2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MTQ2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TR112_YEAST	TRM112	physical	11283351
ERF1_YEAST	SUP45	physical	15509572
CRX_HUMAN	CRX	physical	27107014
ZN426_HUMAN	ZNF426	physical	27107014

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.