UniProt ID | NIT3_YEAST | |
---|---|---|
UniProt AC | P49954 | |
Protein Name | Omega-amidase NIT3 {ECO:0000303|PubMed:28373563} | |
Gene Name | NIT3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 291 | |
Subcellular Localization | ||
Protein Description | Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting 2-oxoglutaramate and 2-oxosuccinamate to biologically useful 2-oxoglutarate and oxaloacetate, respectively.. | |
Protein Sequence | MSASKILSQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPYSTDQFRKYSEVINPKEPSTSVQFLSNLANKFKIILVGGTIPELDPKTDKIYNTSIIFNEDGKLIDKHRKVHLFDVDIPNGISFHESETLSPGEKSTTIDTKYGKFGVGICYDMRFPELAMLSARKGAFAMIYPSAFNTVTGPLHWHLLARSRAVDNQVYVMLCSPARNLQSSYHAYGHSIVVDPRGKIVAEAGEGEEIIYAELDPEVIESFRQAVPLTKQRRFDVYSDVNAH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | LVQLSGSSPDKMANL EEECCCCCHHHHHHH | 40.41 | 23749301 | |
34 | Phosphorylation | ANLQRAATFIERAMK HHHHHHHHHHHHHHH | 24.94 | 28889911 | |
47 | Ubiquitination | MKEQPDTKLVVLPEC HHHCCCCEEEECCCH | 46.82 | 23749301 | |
74 | Acetylation | YSEVINPKEPSTSVQ HHCCCCCCCCCCHHH | 77.19 | 24489116 | |
89 | Acetylation | FLSNLANKFKIILVG HHHHHHHCCEEEEEC | 42.29 | 24489116 | |
105 | Acetylation | TIPELDPKTDKIYNT CCCCCCCCCCCEECE | 69.86 | 24489116 | |
110 | Phosphorylation | DPKTDKIYNTSIIFN CCCCCCEECEEEEEC | 20.37 | 27017623 | |
112 | Phosphorylation | KTDKIYNTSIIFNED CCCCEECEEEEECCC | 12.34 | 27017623 | |
121 | Acetylation | IIFNEDGKLIDKHRK EEECCCCCEEECCCC | 55.37 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NIT3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NIT3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NIT3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NIT3_YEAST | NIT3 | physical | 12833551 | |
SCC1_YEAST | MCD1 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
NOT1_YEAST | CDC39 | genetic | 27708008 | |
RRP42_YEAST | RRP42 | genetic | 27708008 | |
XPO1_YEAST | CRM1 | genetic | 27708008 | |
MOB1_YEAST | MOB1 | genetic | 27708008 | |
SLN1_YEAST | SLN1 | genetic | 27708008 | |
NSE1_YEAST | NSE1 | genetic | 27708008 | |
SMC4_YEAST | SMC4 | genetic | 27708008 | |
LCB1_YEAST | LCB1 | genetic | 27708008 | |
NOG2_YEAST | NOG2 | genetic | 27708008 | |
SEC16_YEAST | SEC16 | genetic | 27708008 | |
NAB3_YEAST | NAB3 | genetic | 27708008 | |
DIM1_YEAST | DIM1 | genetic | 27708008 | |
MED10_YEAST | NUT2 | genetic | 27708008 | |
2ABA_YEAST | CDC55 | genetic | 27453043 | |
DCOR_YEAST | SPE1 | genetic | 27453043 | |
BUB1_YEAST | BUB1 | genetic | 27453043 | |
VPS1_YEAST | VPS1 | genetic | 27453043 | |
DCAM_YEAST | SPE2 | genetic | 27453043 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-34, AND MASSSPECTROMETRY. |