YE16_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YE16_YEAST
• UniProt AC: P40101
• Protein Name: Uncharacterized protein YER186C
• Gene Name: YER186C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 306
• Protein Sequence: MLWHPDGYEPRVKAIEEEIYANEDRKDVPDKFKFDTVTKTGMVKLRVFKDDLIFKSQRSINLFASRKHPFKSFTADGEGLPLFAFRTKKPFFVRRDYVGFLFYQYEILKNGDFPEESDYEVKGECDGFTLFKVLFCTVKVKKTSYYRNKERISHILELNFGKKEDFRILTLVRCSEIRSVYVVEDKKVIMKWVFTSESKFNLNSSLFIIKAAIGCLPEVGDSIEDIPKFDWDSCPTIGCMCRTKEALFQPESRKDMHICPQLFLGETGPPHYNESSVPWLTKMNICISVLINFLEYTDFMSWMQDN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YE16_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YE16_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YE16_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YE16_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRP6_YEAST	PRP6	genetic	27708008
MCM1_YEAST	MCM1	genetic	27708008
STU1_YEAST	STU1	genetic	27708008
PRP9_YEAST	PRP9	genetic	27708008
CDC37_YEAST	CDC37	genetic	27708008
GNA1_YEAST	GNA1	genetic	27708008
SPC97_YEAST	SPC97	genetic	27708008
HACD_YEAST	PHS1	genetic	27708008
CLP1_YEAST	CLP1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.