UniProt ID | YAN8_YEAST | |
---|---|---|
UniProt AC | P39564 | |
Protein Name | Uncharacterized protein YAR068W | |
Gene Name | YAR068W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 161 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPQVQSWFPVQKQPTLAVTFTPLPQLSHAHLPLPPSHLVTKTDAMFQHQLLPTQLQPFPPSHTPLLLLLTVTTMAVTPRLSLLNVLKKLQQPPFLQNHTLLLPLLTVTTTAVTPRLSLPRLPNKHHWPLAQSPSLLLQLLILLLPAPSLVLSFNPKVWLLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YAN8_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YAN8_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YAN8_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YAN8_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PAU5_YEAST | PAU5 | genetic | 27708008 | |
MPCP_YEAST | MIR1 | genetic | 27708008 | |
SIC1_YEAST | SIC1 | genetic | 27708008 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
PHB2_YEAST | PHB2 | genetic | 27708008 | |
ELM1_YEAST | ELM1 | genetic | 27708008 | |
EFM6_YEAST | YNL024C | genetic | 27708008 | |
PHO80_YEAST | PHO80 | genetic | 27708008 | |
PDE2_YEAST | PDE2 | genetic | 27708008 | |
HSP7F_YEAST | SSE1 | genetic | 27708008 | |
YME1_YEAST | YME1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...