RM31_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RM31_YEAST
• UniProt AC: P14063
• Protein Name: 54S ribosomal protein L31, mitochondrial
• Gene Name: MRPL31
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 131
• Subcellular Localization: Mitochondrion . Mitoribosomes are tethered to the mitochondrial inner membrane and spatially aligned with the membrane insertion machinery through two distinct membrane contact sites, formed by the 21S rRNA expansion segment 96-ES1 and the inner memb
• Protein Description: Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane..
• Protein Sequence: MFGPFKLTSPVAGGLLWKIPWRMSTHQKTRQRERLRNVDQVIKQLTLGLHVQRCQDKGLTYQEAMESKKKYKPRSKSLRLLNKPSVFPKENQMSSKDKYWTFDKKAVGYRKGIHKVPKWTKISIRKAPKFF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
67	Phosphorylation	TYQEAMESKKKYKPR CHHHHHHHHCCCCCC	36.37	27017623
77	Phosphorylation	KYKPRSKSLRLLNKP CCCCCCHHHHHHCCC	21.70	24961812

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RM31_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RM31_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RM31_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACT_YEAST	ACT1	genetic	27708008
GWT1_YEAST	GWT1	genetic	27708008
MAK11_YEAST	MAK11	genetic	27708008
ASK1_YEAST	ASK1	genetic	27708008
TIM23_YEAST	TIM23	genetic	27708008
STU1_YEAST	STU1	genetic	27708008
CND2_YEAST	BRN1	genetic	27708008
KPC1_YEAST	PKC1	genetic	27708008
MAK5_YEAST	MAK5	genetic	27708008
TIM22_YEAST	TIM22	genetic	27708008
PANK_YEAST	CAB1	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
PRS8_YEAST	RPT6	genetic	27708008
ARPC5_YEAST	ARC15	genetic	27708008
NOG2_YEAST	NOG2	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.