UniProt ID | RPC5_YEAST | |
---|---|---|
UniProt AC | P36121 | |
Protein Name | DNA-directed RNA polymerase III subunit RPC5 | |
Gene Name | RPC37 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 282 | |
Subcellular Localization | Nucleus . | |
Protein Description | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. The RPC53/RPC4-RPC37/RPC5 subcomplex is required for terminator recognition and reinitiation.. | |
Protein Sequence | MSIDNKLFVTEEDEEDRTQDRADVEDESNDIDMIADENGTNSAIANEQEEKSEEVKAEDDTGEEEEDDPVIEEFPLKISGEEESLHVFQYANRPRLVGRKPAEHPFISAARYKPKSHLWEIDIPLDEQAFYNKDKAESEWNGVNVQTLKGVGVENNGQYAAFVKDMQVYLVPIERVAQLKPFFKYIDDANVTRKQEDARRNPNPSSQRAQVVTMSVKSVNDPSQNRLTGSLLAHKVADEEANIELTWAEGTFEQFKDTIVKEAEDKTLVALEKQEDYIDNLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | EEDEEDRTQDRADVE CCCCCCCCCCCHHCC | 47.33 | 28889911 | |
28 | Phosphorylation | RADVEDESNDIDMIA CHHCCCCCCCCEEEE | 52.72 | 27017623 | |
52 | Phosphorylation | ANEQEEKSEEVKAED HCCHHHHHHHCCCCC | 42.12 | 21440633 | |
61 | Phosphorylation | EVKAEDDTGEEEEDD HCCCCCCCCCCCCCC | 59.83 | 22369663 | |
184 | Acetylation | AQLKPFFKYIDDANV HHCCHHHHHCCCCCC | 41.49 | 24489116 | |
185 | Phosphorylation | QLKPFFKYIDDANVT HCCHHHHHCCCCCCC | 12.39 | 27017623 | |
192 | Phosphorylation | YIDDANVTRKQEDAR HCCCCCCCCCHHHHH | 31.77 | 27017623 | |
205 | Phosphorylation | ARRNPNPSSQRAQVV HHHCCCCCHHCEEEE | 45.82 | 30377154 | |
206 | Phosphorylation | RRNPNPSSQRAQVVT HHCCCCCHHCEEEEE | 25.58 | 28889911 | |
217 | Ubiquitination | QVVTMSVKSVNDPSQ EEEEEEEECCCCCCC | 41.18 | 23749301 | |
217 | Acetylation | QVVTMSVKSVNDPSQ EEEEEEEECCCCCCC | 41.18 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPC5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPC5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPC5_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-18; SER-52 AND THR-61,AND MASS SPECTROMETRY. | |
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-61, AND MASSSPECTROMETRY. |