EFG1P_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EFG1P_YEAST
• UniProt AC: Q3E705
• Protein Name: rRNA-processing protein EFG1
• Gene Name: EFG1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 233
• Subcellular Localization: Nucleus, nucleolus .
• Protein Description: Involved in rRNA processing. Required growth at elevated temperatures, resistance to hydroxyurea and for cell cycle progression..
• Protein Sequence: MAKLQRKRSKALGSSLEMSQIMDAGTNKIKRRIRDLERLLKKKKDILPSTVIIEKERNLQALRLELQNNELKNKIKANAKKYHMVRFFEKKKALRKYNRLLKKIKESGADDKDLQQKLRATKIELCYVINFPKTEKYIALYPNDTPSTDPKGVELTNLRREQFLKLVAERMDANTLNVSFEEILKGKKLDEDSIGLTLSPDKDHEDGSQVSPTQDRKELDQVVGEDEKDDFFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	KRSKALGSSLEMSQI HHHHHHCCCCHHHHH	32.38	24909858
15	Phosphorylation	RSKALGSSLEMSQIM HHHHHCCCCHHHHHH	26.93	21440633
43	Ubiquitination	LERLLKKKKDILPST HHHHHHHCCCCCCCE	54.83	17644757
44	Ubiquitination	ERLLKKKKDILPSTV HHHHHHCCCCCCCEE	59.90	17644757
55	Ubiquitination	PSTVIIEKERNLQAL CCEEEEEHHHCHHHH	52.11	17644757
55	Acetylation	PSTVIIEKERNLQAL CCEEEEEHHHCHHHH	52.11	24489116
193	Phosphorylation	GKKLDEDSIGLTLSP CCCCCCCCCCCEECC	19.26	22369663
197	Phosphorylation	DEDSIGLTLSPDKDH CCCCCCCEECCCCCC	21.70	25521595
199	Phosphorylation	DSIGLTLSPDKDHED CCCCCEECCCCCCCC	26.31	22369663
208	Phosphorylation	DKDHEDGSQVSPTQD CCCCCCCCCCCCCCC	39.47	19823750
211	Phosphorylation	HEDGSQVSPTQDRKE CCCCCCCCCCCCHHH	18.00	17330950
213	Phosphorylation	DGSQVSPTQDRKELD CCCCCCCCCCHHHHH	35.28	24909858

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EFG1P_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EFG1P_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EFG1P_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SSBP1_YEAST	SBP1	physical	16554755
FBRL_YEAST	NOP1	physical	16554755
GIS2_YEAST	GIS2	physical	16554755
RRP8_YEAST	RRP8	genetic	22588997
NOP56_YEAST	NOP56	physical	29481617
RL8B_YEAST	RPL8B	physical	29481617
FBRL_YEAST	NOP1	physical	29481617
RL8A_YEAST	RPL8A	physical	29481617
SMC2_YEAST	SMC2	physical	29481617
NOP58_YEAST	NOP58	physical	29481617
RL16A_YEAST	RPL16A	physical	29481617
NSR1_YEAST	NSR1	physical	29481617
RL5_YEAST	RPL5	physical	29481617
RL14A_YEAST	RPL14A	physical	29481617
RL35A_YEAST	RPL35A	physical	29481617
RL35B_YEAST	RPL35A	physical	29481617
RS2_YEAST	RPS2	physical	29481617
DED1_YEAST	DED1	physical	29481617
RL17B_YEAST	RPL17B	physical	29481617
TRF5_YEAST	TRF5	physical	29481617
RS23A_YEAST	RPS23A	physical	29481617
RS23B_YEAST	RPS23A	physical	29481617
RS24A_YEAST	RPS24B	physical	29481617
RS24B_YEAST	RPS24B	physical	29481617
RL23A_YEAST	RPL23A	physical	29481617
RL23B_YEAST	RPL23A	physical	29481617
RL27A_YEAST	RPL27A	physical	29481617
RL24B_YEAST	RPL24B	physical	29481617
SSZ1_YEAST	SSZ1	physical	29481617
RS26B_YEAST	RPS26B	physical	29481617
RL22A_YEAST	RPL22A	physical	29481617
GYP5_YEAST	GYP5	physical	29481617
SRO9_YEAST	SRO9	physical	29481617
UTP8_YEAST	UTP8	physical	29481617
RS12_YEAST	RPS12	physical	29481617
RS31_YEAST	RPS31	physical	29481617
RS10A_YEAST	RPS10A	physical	29481617
SNU13_YEAST	SNU13	physical	29481617
GAR1_YEAST	GAR1	physical	29481617
NOG1_YEAST	NOG1	physical	29481617
SYYC_YEAST	TYS1	physical	29481617
ATPB_YEAST	ATP2	physical	29481617

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.